DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. Nature 1998 imex curation Nern A., Arkowitz RA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nern A., Arkowitz RA. DIP original experiment: DIP-265129X Nature 1998 IMEx A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. Nature 1998 imex curation Nern A., Arkowitz RA. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Nern A., Arkowitz RA. DIP original experiment: DIP-265130X Nature 1998 IMEx A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. Nature 1998 imex curation Nern A., Arkowitz RA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nern A., Arkowitz RA. DIP original experiment: DIP-265126X Nature 1998 IMEx A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. Nature 1998 imex curation Nern A., Arkowitz RA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nern A., Arkowitz RA. DIP original experiment: DIP-265128X Nature 1998 IMEx A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. A GTP-exchange factor required for cell orientation. Nature 1998 imex curation Nern A., Arkowitz RA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nern A., Arkowitz RA. DIP original experiment: DIP-265127X Nature 1998 IMEx A GTP-exchange factor required for cell orientation. gbb_yeast Guanine nucleotide-binding protein subunit beta YOR50-2 YOR212W STE4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAAHQMDSITYSNNVTQQYIQPQSLQDISAVEDEIQNKIEAARQESKQLHAQINKAKHKIQDASLFQMANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSSSYLDNQGVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGSWDSTMKIWSPGYQ 4B0E26040AAA83E5 4B0E26040AAA83E5 bem1_yeast Bud emergence protein 1 Suppressor of RHO3 protein 1 BEM1 SRO1 YBR200W YBR1412 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKNFKLSKRDSNGSKGRITSADISTPSHDNGSVIKHIKTVPVRYLSSSSTPVKSQRDSSPKNRHNSKDITSPEKVIKAKYSYQAQTSKELSFMEGEFFYVSGDEKDWYKASNPSTGKEGVVPKTYFEVFDRTKPSSVNGSNSSSRKVTNDSLNMGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVEQQQQQSITKPQNKSAKLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVLNNGFDREFERDENQNNIKTLQENDTATFATASQTSNFASTNQDNTLTGEDLKLNKKLSDLSLSGSKQAPAQSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI FB6C525AE9A19181 FB6C525AE9A19181 cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C 30BD644BA9836B2C cdc24_yeast Cell division control protein 24 CLS4 YAL041W CDC24 Calcium regulatory protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MAIQTRFASGTSLSDLKPKPSATSISIPMQNVMNKPVTEQDSLFHICANIRKRLEVLPQLKPFLQLAYQSSEVLSERQSLLLSQKQHQELLKSNGANRDSSDLAPTLRSSSISTATSLMSMEGISYTNSNPSATPNMEDTLLTFSMGILPITMDCDPVTQLSQLFQQGAPLCILFNSVKPQFKLPVIASDDLKVCKKSIYDFILGCKKHFAFNDEELFTISDVFANSTSQLVKVLEVVETLMNSSPTIFPSKSKTQQIMNAENQHRHQPQQSSKKHNEYVKIIKEFVATERKYVHDLEILDKYRQQLLDSNLITSEELYMLFPNLGDAIDFQRRFLISLEINALVEPSKQRIGALFMHSKHFFKLYEPWSIGQNAAIEFLSSTLHKMRVDESQRFIINNKLELQSFLYKPVQRLCRYPLLVKELLAESSDDNNTKELEAALDISKNIARSINENQRRTENHQVVKKLYGRVVNWKGYRISKFGELLYFDKVFISTTNSSSEPEREFEVYLFEKIIILFSEVVTKKSASSLILKKKSSTSASISASNITDNNGSPHHSYHKRHSNSSSSNNIHLSSSSAAAIIHSSTNSSDNNSNNSSSSSLFKLSANEPKLDLRGRIMIMNLNQIIPQNNRSLNITWESIKEQGNFLLKFKNEETRDNWSSCLQQLIHDLKNEQFKARHHSSTSTTSSTAKSSSMMSPTTTMNTPNHHNSRQTHDSMASFSSSHMKRVSDVLPKRRTTSSSFESEIKSISENFKNSIPESSILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY 856BCAF4EB0A67D1 856BCAF4EB0A67D1 cdc24p-ste4p-1 3 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait P11433:p.Ser189Phe S189F Mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S F This feature has been corrected as a result of our quality control procedures. The original label was 'S189F Mutation'. Wed May 02 19:05:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser189phe' Tue Jun 30 19:53:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser189Phe' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc24p-bem1p-1 4 7 unspecified role unspecified role prey prey 372-551 Binding Region 372-551 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc24p-ste4p-2 2 6 unspecified role unspecified role prey prey HIS Tag HIS Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction cdc24p-ste4p-3 1 6 unspecified role unspecified role prey prey 170-246 Binding Region 170-246 Binding Region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc24p-cdc42p-1 5 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association