DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of a specific acyl-enzyme complex formed between beta-casomorphin-7 and porcine pancreatic elastase. Structure of a specific acyl-enzyme complex formed between beta-casomorphin-7 and porcine pancreatic elastase. Nature structural biology 1997 imex curation Wilmouth RC., Clifton IJ., Robinson CV., Roach PL., Aplin RT., Westwood NJ., Hajdu J., Schofield CJ. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wilmouth RC., Clifton IJ., Robinson CV., Roach PL., Aplin RT., Westwood NJ., Hajdu J., Schofield CJ. DIP original experiment: DIP-263110X Nature structural biology 1997 IMEx Structure of a specific acyl-enzyme complex formed between beta-casomorphin-7 and porcine pancreatic elastase. bcm7 BETA-CASOMORPHIN-7 protein protein human Homo sapiens Human YPFVEPI cela1_pig Chymotrypsin-like elastase family member 1 CELA1 ELA1 Elastase-1 protein protein pig Sus scrofa (Pig) Pig MLRLLVVASLVLYGHSTQDFPETNARVVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN DIP protein P00772 original sequence version: 150 BF07D6855BB50FE2 bcm7-cela1-1 1 3 unspecified role unspecified role unspecified role unspecified role 27-266 binding region 27-266 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain pig Sus scrofa (Pig) Pig 2 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction