DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. Science (New York, N.Y.) 1997 imex curation Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. DIP original experiment: DIP-268322X Science (New York, N.Y.) 1997 IMEx Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. Science (New York, N.Y.) 1997 imex curation Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. DIP original experiment: DIP-268323X Science (New York, N.Y.) 1997 IMEx Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. dnak_ecoli Chaperone protein DnaK dnaK groP grpF seg b0014 Heat shock protein 70 Heat shock 70 kDa protein HSP70 JW0013 protein protein ecoli Escherichia coli (strain K12) MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK DIP protein P0A6Y8 original sequence version: 44 DIP protein P0A6Y8 original sequence version: 96 DIP protein P0A6Y8 original sequence version: 91 DIP protein P0A6Y8 original sequence version: 119 DIP protein P0A6Y8 original sequence version: 95 5A8589B21D7CD9C1 grpe_ecoli Protein GrpE b2614 grpE HSP-70 cofactor Heat shock protein B25.3 HSP24 JW2594 protein protein ecoli Escherichia coli (strain K12) MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA DIP protein P09372 original sequence version: 94 DIP protein P09372 original sequence version: 143 DIP protein P09372 original sequence version: null CDC4CD9D08AD4BEF dnak-grpe-2 1 4 unspecified role unspecified role unspecified role unspecified role 34-197 binding region 34-197 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role 1-138 binding region 1-138 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction grpe-dnak-3 2 4 unspecified role unspecified role bait bait ecolx Escherichia coli 3 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction