DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268306X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268303X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268312X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268304X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268313X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268310X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268315X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268307X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268311X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268316X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268308X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268302X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268314X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268309X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Science (New York, N.Y.) 1997 imex curation Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268305X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE ced9_caeel Apoptosis regulator ced-9 Cell death protein 9 ced-9 T07C4.8 protein protein caeel Caenorhabditis elegans MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK DIP protein P41958 original sequence version: 125 DIP protein P41958 original sequence version: 83 7603675E490DD3EB bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK DIP protein Q13323 original sequence version: 131 DIP protein Q13323 original sequence version: 119 89034F4443F5A136 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E p30429-2 Cell death protein 4 Short C35D10.9 ced-4 protein protein caeel Caenorhabditis elegans MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPKTTEETVIRPEDFPKFMQLHQKFYDSLKNFACC Major transcript. DB2A7969BDA50AF8 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F ced3_caeel Cell death protein 3 ced-3 Caspase ced-3 C48D1.2 protein protein caeel Caenorhabditis elegans MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKAVQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPAGYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSSANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVDAPTISRVFDEKTMYRNFSSPRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQTSQGSNILKQMPEMTSRLLKKFYFWPEARNSAV DIP protein P42573 original sequence version: 122 DIP protein P42573 original sequence version: 131 DIP protein P42573 original sequence version: 85 722D5831F94DAA69 ced_4-ced_9-1 12 17 unspecified role unspecified role prey prey AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 20 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association bcl2l1-bik-6 6 18 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ced_4-bcl2l1-1 1 16 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q07817-1:p.Gly134_Asn136delinsAlaIleLeu 134-136 mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain GVN AIL Wed Aug 02 13:42:47 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_val_gln134-136ala_ile_leu' Wed May 02 17:20:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_val_asn134-136ala_ile_leu' Tue Jun 30 20:02:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly134_Asn136delinsAlaIleLeu' human Homo sapiens Human 20 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association ced_9-ced_4-3 2 17 unspecified role unspecified role bait bait AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range 160-280 binding region 160-280 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association ced_3-ced_4-8 9 23 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 20 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association casp8-ced_4-1 5 22 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 20 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association bcl2l1-bax-10 8 21 unspecified role unspecified role prey prey FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 16 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ced_3-ced_4-9 3 23 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 20 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 1-301 binding region 1-301 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association ced_9-ced_4-4 4 17 unspecified role unspecified role bait bait AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range 160-280 binding region 160-280 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association bcl2l1-bak1-5 11 19 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ced_3-ced_4-10 13 23 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 20 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association bcl2l1-ced_4-1 15 16 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q07817-1:p.Gly134_Asn136delinsAlaIleLeu 134-136 mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain GVN AIL Wed Aug 02 13:54:20 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_val_gln134-136ala_ile_leu' Wed May 02 19:20:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_val_asn134-136ala_ile_leu' Tue Jun 30 19:48:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly134_Asn136delinsAlaIleLeu' human Homo sapiens Human 20 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association ced_3-ced_4-11 10 23 unspecified role unspecified role bait bait 1-130 binding region 1-130 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 99-502 binding region 99-502 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 20 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association casp8-bcl2l1-1 7 22 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association bcl2l1-bax-11 14 21 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association