DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The crystal structure of a class II fructose-1,6-bisphosphate aldolase shows a novel binuclear metal-binding active site embedded in a familiar fold. The crystal structure of a class II fructose-1,6-bisphosphate aldolase shows a novel binuclear metal-binding active site embedded in a familiar fold. Structure (London, England : 1993) 1996 imex curation Cooper SJ., Leonard GA., McSweeney SM., Thompson AW., Naismith JH., Qamar S., Plater A., Berry A., Hunter WN. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cooper SJ., Leonard GA., McSweeney SM., Thompson AW., Naismith JH., Qamar S., Plater A., Berry A., Hunter WN. DIP original experiment: DIP-263080X Structure (London, England : 1993) 1996 IMEx The crystal structure of a class II fructose-1,6-bisphosphate aldolase shows a novel binuclear metal-binding active site embedded in a familiar fold. alf_ecoli Fructose-bisphosphate aldolase class 2 fbaA fba fda Fructose-1,6-bisphosphate aldolase Fructose-bisphosphate aldolase class II b2925 JW2892 protein protein ecoli Escherichia coli (strain K12) MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL DIP protein P0AB71 original sequence version: 85 7A076D9EA62FBEC4 fbaa-2 1 2 unspecified role unspecified role unspecified role unspecified role 2-359 binding region 2-359 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction