DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The solution structure of human thioredoxin complexed with its target from Ref-1 reveals peptide chain reversal. The solution structure of human thioredoxin complexed with its target from Ref-1 reveals peptide chain reversal. Structure (London, England : 1993) 1996 imex curation Qin J., Clore GM., Kennedy WP., Kuszewski J., Gronenborn AM. Only protein-protein interactions in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Qin J., Clore GM., Kennedy WP., Kuszewski J., Gronenborn AM. DIP original experiment: DIP-263077X Structure (London, England : 1993) 1996 IMEx The solution structure of human thioredoxin complexed with its target from Ref-1 reveals peptide chain reversal. thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV DIP protein P10599 original sequence version: 174 DIP protein P10599 original sequence version: 133 DIP protein P10599 original sequence version: 181 DIP protein P10599-1 original sequence version: 180 256F4E3C8A187693 apex1_human DNA-(apurinic or apyrimidinic site) endonuclease Apurinic-apyrimidinic endonuclease 1 APEX nuclease APE1 APEX1 APE APEX APX HAP1 REF1 REF-1 Redox factor-1 protein protein human Homo sapiens Human MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL DIP protein P27695 original sequence version: 139 DIP protein P27695 original sequence version: 152 DIP protein P27695 original sequence version: 187 B88579C01BAF80C6 apex1-txn-1 1 3 unspecified role unspecified role unspecified role unspecified role 59-71 binding region 59-71 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction