DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety. Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety. Structure (London, England : 1993) 1994 imex curation Bourne Y., Mazurier J., Legrand D., Rougé P., Montreuil J., Spik G., Cambillau C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bourne Y., Mazurier J., Legrand D., Rougé P., Montreuil J., Spik G., Cambillau C. DIP original experiment: DIP-263066X Structure (London, England : 1993) 1994 IMEx Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety. Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety. Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety. Structure (London, England : 1993) 1994 imex curation Bourne Y., Mazurier J., Legrand D., Rougé P., Montreuil J., Spik G., Cambillau C. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bourne Y., Mazurier J., Legrand D., Rougé P., Montreuil J., Spik G., Cambillau C. DIP original experiment: DIP-263065X Structure (London, England : 1993) 1994 IMEx Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety. lecb_latoc Lectin beta-1 and beta-2 chains protein protein latoc Lathyrus ochrus Yellow-flowered pea TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNAATNVLTVSLTYPN DIP protein P04122 original sequence version: 92 C9AD28FC03A48215 trfl_human Lactotransferrin LTF LF Talalactoferrin GIG12 Growth-inhibiting protein 12 protein protein human Homo sapiens Human MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK DIP protein P02788 original sequence version: 141 DIP protein P02788 original sequence version: 187 0489CABA6D13C098 lec2_latoc Mannose/glucose-specific lectin alpha 2 chain protein protein latoc Lathyrus ochrus Yellow-flowered pea ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFNSELSVTSSSN DIP protein P12307 original sequence version: 75 lec2_latoc-lecb_latoc-1 2 4 unspecified role unspecified role unspecified role unspecified role 110-268 binding region 110-268 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 5 unspecified role unspecified role unspecified role unspecified role latoc Lathyrus ochrus Yellow-flowered pea 3 unspecified role unspecified role unspecified role unspecified role latoc Lathyrus ochrus Yellow-flowered pea physical association physical association lec2_latoc-lecb_latoc-2 1 5 unspecified role unspecified role unspecified role unspecified role latoc Lathyrus ochrus Yellow-flowered pea 3 unspecified role unspecified role unspecified role unspecified role latoc Lathyrus ochrus Yellow-flowered pea direct interaction direct interaction