DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of a multisubunit complex that promotes DNA branch migration. Structure of a multisubunit complex that promotes DNA branch migration. Nature 1995 imex curation Parsons CA., Stasiak A., Bennett RJ., West SC. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Parsons CA., Stasiak A., Bennett RJ., West SC. DIP original experiment: DIP-267005X Nature 1995 IMEx Structure of a multisubunit complex that promotes DNA branch migration. Structure of a multisubunit complex that promotes DNA branch migration. Structure of a multisubunit complex that promotes DNA branch migration. Nature 1995 imex curation Parsons CA., Stasiak A., Bennett RJ., West SC. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Parsons CA., Stasiak A., Bennett RJ., West SC. DIP original experiment: DIP-267006X Nature 1995 IMEx Structure of a multisubunit complex that promotes DNA branch migration. ruva_ecoli Holliday junction ATP-dependent DNA helicase RuvA ruvA b1861 JW1850 protein protein ecoli Escherichia coli (strain K12) MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRMVSKIARPDASSETLIREALRAAL DIP protein P0A809 original sequence version: 51 DIP protein P0A809 original sequence version: 96 DIP protein P0A809 original sequence version: 90 805DDB79DC5A8385 ruvb_ecoli Holliday junction ATP-dependent DNA helicase RuvB ruvB b1860 JW1849 protein protein ecoli Escherichia coli (strain K12) MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP DIP protein P0A812 original sequence version: 46 DIP protein P0A812 original sequence version: 100 79BAB4A9A5687F7C ruva-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association ruva-ruvb-2 2 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 3 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction