IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Oncotarget 2017 imex curation Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. Accepted 2018-JAN-08 AT 09:11 GMT AT 09:11 GMT by ORCHARD Oncotarget 2017 imex curation Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Oncotarget 2017 imex curation Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. Accepted 2018-JAN-08 AT 09:11 GMT AT 09:11 GMT by ORCHARD Oncotarget 2017 imex curation Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Oncotarget 2017 imex curation Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion http://www.lgcstandards-atcc.org/products/all/HTB-21.aspx?gclid=Cj0KEQjw6deeBRCswoauquC8haUBEiQAdq5zh_8UuH2LvwJZhI8PgJMkbdeRwWUGeOBeWeE8leDHvmUaAqa18P8HAQ&geo_country=gb ATCC HTB-21 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. Accepted 2018-JAN-08 AT 09:11 GMT AT 09:11 GMT by ORCHARD Oncotarget 2017 imex curation Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Oncotarget 2017 imex curation Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. Accepted 2018-JAN-08 AT 09:11 GMT AT 09:11 GMT by ORCHARD Oncotarget 2017 imex curation Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Oncotarget 2017 imex curation Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. Accepted 2018-JAN-08 AT 09:11 GMT AT 09:11 GMT by ORCHARD Oncotarget 2017 imex curation Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Measurements of heterotypic associations between cluster of differentiation CD74 and CD44 in human breast cancer-derived cells. Oncotarget 2017 imex curation Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion http://www.lgcstandards-atcc.org/products/all/HTB-21.aspx?gclid=Cj0KEQjw6deeBRCswoauquC8haUBEiQAdq5zh_8UuH2LvwJZhI8PgJMkbdeRwWUGeOBeWeE8leDHvmUaAqa18P8HAQ&geo_country=gb ATCC HTB-21 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer I have not been able to identify isoforms found in the IPs here- specificity of antibodies is not known/not possible to find. I expect the CD44S form is isoform 1 - but as Uniprot does not mention the term "CD44S" it is not possible to confirm. CD74 - literature gives conflicting reports of 4 isoforms, Uniprot only lists 3- - no idea which isoform p41 corresponds to, or identity of the p41 band shown here. Accepted 2018-JAN-08 AT 09:11 GMT AT 09:11 GMT by ORCHARD Oncotarget 2017 imex curation cd44_human CD44 antigen Epican CDw44 Phagocytic glycoprotein I Extracellular matrix receptor III HUTCH-I Phagocytic glycoprotein 1 GP90 lymphocyte homing/adhesion receptor Hermes antigen Hyaluronate receptor Heparan sulfate proteoglycan CD44 LHR MDU2 MDU3 MIC4 protein protein human Homo sapiens Human MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV DIP protein P16070 original sequence version: 142 DIP protein P16070 original sequence version: 157 BB9B66B19B970349 hg2a_human HLA class II histocompatibility antigen gamma chain DHLAG HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain CD74 protein protein human Homo sapiens Human MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM 27A13F252D5FB91D cd44-cd74-1 6 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization Figure 5A cd44-cd74-2 2 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization Figure 5B cd44-cd74-3 4 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization Figure 5C q3t4twrt-1 3 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 6D cd44-cd74-4 3 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 6C It is stated that CD74 interacts with both CD44s (standard) and CD44v (variant) isoform(s). (Two bands, of molecular weights of 80 and 90 kDa, are visible). To further demonstrate interaction between CD74 and CD44, Co-IP was carried out. cd44-cd74-5 1 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 6D cd74-cd44-1 5 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 6C cd74-cd44-2 1 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 6C cd44-cd74-6 5 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 6D