IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Cell reports 2017 imex curation Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. I have entered most expts as in "293" cells rather than 293S or 293T - as I cannot always work out which they are using. ALK1 is of human origin by residue mapping. luca.jovine@ki.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Accepted 2017-OCT-03 AT 11:23 BST AT 11:23 BST by PPORRAS Cell reports 2017 Only protein-protein interactions imex curation imex curation some Exp preps added; done-EBI-16227367 moved to Exp-4 and EBI-16235929 cloned and moved to Exp-3.; I am not sure where the ENG constructs came from Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Cell reports 2017 imex curation Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. I have entered most expts as in "293" cells rather than 293S or 293T - as I cannot always work out which they are using. ALK1 is of human origin by residue mapping. luca.jovine@ki.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Accepted 2017-OCT-03 AT 11:23 BST AT 11:23 BST by PPORRAS Cell reports 2017 Only protein-protein interactions imex curation imex curation some Exp preps added; done-EBI-16227367 moved to Exp-4 and EBI-16235929 cloned and moved to Exp-3.; I am not sure where the ENG constructs came from Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Cell reports 2017 imex curation Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. I have entered most expts as in "293" cells rather than 293S or 293T - as I cannot always work out which they are using. ALK1 is of human origin by residue mapping. luca.jovine@ki.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Accepted 2017-OCT-03 AT 11:23 BST AT 11:23 BST by PPORRAS Cell reports 2017 Only protein-protein interactions imex curation imex curation some Exp preps added; done-EBI-16227367 moved to Exp-4 and EBI-16235929 cloned and moved to Exp-3.; I am not sure where the ENG constructs came from Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Cell reports 2017 imex curation Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. I have entered most expts as in "293" cells rather than 293S or 293T - as I cannot always work out which they are using. ALK1 is of human origin by residue mapping. luca.jovine@ki.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Accepted 2017-OCT-03 AT 11:23 BST AT 11:23 BST by PPORRAS Cell reports 2017 Only protein-protein interactions imex curation imex curation some Exp preps added; done-EBI-16227367 moved to Exp-4 and EBI-16235929 cloned and moved to Exp-3.; I am not sure where the ENG constructs came from Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Cell reports 2017 imex curation Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. I have entered most expts as in "293" cells rather than 293S or 293T - as I cannot always work out which they are using. ALK1 is of human origin by residue mapping. luca.jovine@ki.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293s Human 293S cell line Human 293s 293S cell line molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Accepted 2017-OCT-03 AT 11:23 BST AT 11:23 BST by PPORRAS Cell reports 2017 Only protein-protein interactions imex curation imex curation some Exp preps added; done-EBI-16227367 moved to Exp-4 and EBI-16235929 cloned and moved to Exp-3.; I am not sure where the ENG constructs came from Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1. Cell reports 2017 imex curation Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. I have entered most expts as in "293" cells rather than 293S or 293T - as I cannot always work out which they are using. ALK1 is of human origin by residue mapping. luca.jovine@ki.se 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L., Saito T., Bokhove M., Croci R., Zamora-Caballero S., Han L., Letarte M., de Sanctis D., Jovine L. the crystal resolution is on the high side (4.5A) - I think 5A is the limit? In Pull-Downs why did they not use WB rather than CB staining for detection? I have left in ALK1 (human) interactions although there is no other interaction shown with ALK1. ALK1 is of human origin by residue mapping. luca.jovine@ki.se Accepted 2017-OCT-03 AT 11:23 BST AT 11:23 BST by PPORRAS Cell reports 2017 Only protein-protein interactions imex curation imex curation some Exp preps added; done-EBI-16227367 moved to Exp-4 and EBI-16235929 cloned and moved to Exp-3.; I am not sure where the ENG constructs came from egln_human Endoglin ENG END protein protein human Homo sapiens Human MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA DIP protein P17813 original sequence version: 151 49CA2CE013298D17 acvl1_human Serine/threonine-protein kinase receptor R3 ACVRL1 ACVRLK1 ALK1 Activin receptor-like kinase 1 TGF-B superfamily receptor type I protein protein human Homo sapiens Human MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLGLAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ DIP protein P37023 original sequence version: 153 On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May bind activin as well mint homomint Defects in ACVRL1 are the cause of hereditary hemorrhagic telangiectasia type 2 (HHT2) [MIM:600376]; also known as Osler-Rendu-Weber syndrome 2 (ORW2). HHT2 is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary, cerebral and hepatic arteriovenous malformations; all secondary manifestations of the underlying vascular dysplasia 074522AA802325DD q9uk05-pro_0000033903 Growth/differentiation factor 2 GDF2 BMP9 Bone morphogenetic protein 9 protein protein human Homo sapiens Human SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR 320 429 9A38976C1A5DFE97 gdf2-1 3 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified human Homo sapiens Human direct interaction direct interaction Table S1 1.87A RFree = 0.233 RWork = 0.214 eng-gdf2-1 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293s Human 293S cell line Human 293s 293S cell line 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified human-293s Human 293S cell line Human 293s 293S cell line direct interaction direct interaction Table S1 4.45A RFree =0.318 RWork =0.286 eng-gdf2-2 6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed association association Figure 2B Myc-MOR co-elutes with His-MOR only in the presence of BMP9 eng-gdf2-3 4 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed conditioned medium conditioned medium OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P17813:p.Asn268Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Wed May 02 16:16:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn268ala' Tue Jun 30 15:41:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn268Ala' P17813:p.Met269Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Wed May 02 19:36:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met269ala' Tue Jun 30 19:08:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met269Ala' P17813:p.Gln270Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q A Thu Aug 17 15:24:03 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'glu270ala' Wed May 02 17:10:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln270ala' Tue Jun 30 19:40:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln270Ala' P17813:p.Ile271Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 15:09:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile271ala' Tue Jun 30 17:46:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile271Ala' P17813:p.Phe290Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:25:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe290ala' Tue Jun 30 18:53:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe290Ala' P17813:p.Asp246Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:20:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp246ala' Tue Jun 30 19:50:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp246Ala' P17813:p.Tyr277Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:12:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277ala' Tue Jun 30 16:42:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Ala' P17813:p.Gln270_Ile271delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain QI AA Thu Aug 17 12:27:47 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_ile270-271ala_ala' Wed May 02 17:09:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln_ile270-271ala_ala' Tue Jun 30 17:11:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln270_Ile271delinsAlaAla' P17813:p.[Asn268Ala;Gln270_Ile271delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain QI AA Thu Aug 17 12:09:56 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'asn268ala,glu_ile270-271ala_ala' Wed May 02 17:48:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn268ala,gln_ile270-271ala_ala' Tue Jun 30 16:46:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn268Ala;Gln270_Ile271delinsAlaAla]' P17813:p.Ser278Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S P Wed May 02 18:13:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser278pro' Tue Jun 30 18:35:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser278Pro' P17813:p.Phe282Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F V Wed May 02 16:22:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe282val' Tue Jun 30 16:49:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe282Val' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed conditioned medium conditioned medium human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Figure 2E, Supp. fig. S4E, Supp 5E no cell line is given for Fig 2E - but judging by text it must be the same as Supp fig 4E. The M269ala mutation altered to "decreasing" rather than disrupting due to comments in text:- "he fraction of protein that is correctly folded and secreted retains BMP9-binding activity". The isolated ZP region does not bind BMP9. eng-eng-1 6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4D The heterodimer forms in the presence and absence of BMP9. eng-eng-2 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed OR1_region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ZP_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Figure 4D-2, Supp 1C, Supp 5E BMP9 binds to His-mECTO in the presence and absence of ECTO-myc. M.Wt of BMP9 monomer is 12 kDa - In fig 4D it runs at ~24, but in Supp 1C runs lower. eng-gdf2-4 5 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Figure 4E eng-gdf2-5 1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed association association Figure 5C MBP and other tags may be present on the ALK1 molecule but the exact vector used is not stated. acvrl1-eng-3 1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Figure 5C-2 MBP and other tags may be present on the ALK1 molecule but the exact vector used is not stated. eng-eng-3 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P17813:p.Cys242Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:19:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys242ser' Tue Jun 30 16:37:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys242Ser' physical association physical association Supp Figure 1C M.Wt of BMP9 monomer is 12 kDa - In fig 4D it runs at ~24, but in Supp 1C runs lower. -so not sure if it is monomer or dimer here, despite text. eng-gdf2-6 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified ecto_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Supp 8, table 1 eng-gdf2-7 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Supp 8, table 1-2 eng-gdf2-8 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed purified purified OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P17813:p.Phe282Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F V Wed May 02 17:48:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe282val' Tue Jun 30 16:38:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe282Val' P17813:p.Ser278Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S P Wed May 02 18:21:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser278pro' Tue Jun 30 17:44:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser278Pro' P17813:p.Gln270_Ile271delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain QI AA Wed May 02 20:08:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln_ile270-271ala_ala' Tue Jun 30 18:03:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln270_Ile271delinsAlaAla' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Supp 8, table 1-3 eng-gdf2-9 4 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed conditioned medium conditioned medium OR1_region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range OR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed conditioned medium conditioned medium human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Supp 3B