IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Rab11a promotes proliferation and invasion through regulation of YAP in non-small cell lung cancer. Rab11a promotes proliferation and invasion through regulation of YAP in non-small cell lung cancer. Oncotarget 2017 imex curation Dong Q., Fu L., Zhao Y., Du Y., Li Q., Qiu X., Wang E. wangenhuacmu@hotmail.com 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dong Q., Fu L., Zhao Y., Du Y., Li Q., Qiu X., Wang E. wangenhuacmu@hotmail.com moc.liamtoh@umcauhnegnaw Accepted 2017-DEC-19 AT 12:05 GMT AT 12:05 GMT by MGT Oncotarget 2017 imex curation Rab11a promotes proliferation and invasion through regulation of YAP in non-small cell lung cancer. Rab11a promotes proliferation and invasion through regulation of YAP in non-small cell lung cancer. Oncotarget 2017 imex curation Dong Q., Fu L., Zhao Y., Du Y., Li Q., Qiu X., Wang E. wangenhuacmu@hotmail.com 14-Feb-2018: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dong Q., Fu L., Zhao Y., Du Y., Li Q., Qiu X., Wang E. wangenhuacmu@hotmail.com moc.liamtoh@umcauhnegnaw Accepted 2017-DEC-19 AT 12:05 GMT AT 12:05 GMT by MGT Oncotarget 2017 imex curation rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI DIP protein P62491 original sequence version: 38 DIP protein P62491-1 original sequence version: 132 DIP protein P62491 original sequence version: 122 DIP protein P62491 original sequence version: 89 DIP protein P62491-1 original sequence version: 137 DIP protein P62491 original sequence version: 136 DIP protein P62491 original sequence version: 137 DIP protein P62491-1 original sequence version: 140 76FC1E113A29B269 yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL DIP protein P46937 original sequence version: 143 DIP protein P46937 original sequence version: 98 DIP protein P46937-1 original sequence version: 110 DIP protein P46937 original sequence version: 149 DIP protein P46937 original sequence version: 153 DIP protein P46937 original sequence version: 157 DIP protein P46937 original sequence version: 160 DIP protein P46937 original sequence version: 122 DIP protein P46937 original sequence version: 124 6145F7049ED338AE yap-rab11a-1 2 3 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig5A As shown in Figure Figure5A,5A, Rab11a and YAP co-immunoprecipitated in both H1299 and H460 cells with or without Rab11a overexpression. yap1-rab11a-1 1 3 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig5A As shown in Figure Figure5A,5A, Rab11a and YAP co-immunoprecipitated in both H1299 and H460 cells with or without Rab11a overexpression.