HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Surfactant Protein A Inhibits Growth and Adherence of Uropathogenic Escherichia coli To Protect the Bladder from Infection. Surfactant Protein A Inhibits Growth and Adherence of Uropathogenic Escherichia coli To Protect the Bladder from Infection. Journal of immunology (Baltimore, Md. : 1950) 2017 imex curation Hashimoto J., Takahashi M., Saito A., Murata M., Kurimura Y., Nishitani C., Takamiya R., Uehara Y., Hasegawa Y., Hiyama Y., Sawada N., Takahashi S., Masumori N., Kuroki Y., Ariki S. nchiaki@sapmed.ac.jp 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Hashimoto J., Takahashi M., Saito A., Murata M., Kurimura Y., Nishitani C., Takamiya R., Uehara Y., Hasegawa Y., Hiyama Y., Sawada N., Takahashi S., Masumori N., Kuroki Y., Ariki S. nchiaki@sapmed.ac.jp Accepted 2017-MAY-22 AT 11:57 BST AT 11:57 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2017 imex curation sftpd_human Pulmonary surfactant-associated protein D SFTPD COLEC7 PSPD SFTP4 Collectin-7 Lung surfactant protein D protein protein human Homo sapiens Human MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 298917699FC40F6A upk1a_human Uroplakin-1a UPK1A TSPAN21 Uroplakin Ia Tetraspanin-21 protein protein human Homo sapiens Human MASAAAAEAEKGSPVVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDVFAGAWIAIFCGFSFFMVASFGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDYMVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAILMWTLPVMLIAMYFYTML 79AF29E0DAEC4E44 mannose mannose Man mannose manno-hexose mannose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fimh_ecoli Type 1 fimbrin D-mannose specific adhesin fimH Protein FimH JW4283 b4320 protein protein ecoli Escherichia coli (strain K12) MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ DIP protein P08191 original sequence version: 96 DIP protein P08191 original sequence version: 112 939204A51658747D upia-spd-1 1 3 unspecified role unspecified role bait bait purified purified c terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role prey prey purified purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 7B We next examined whether SP-D directly bound to UPIa captured by anti-FLAG antibody coated onto microtiter wells. As shown in Fig. 7B, SP-D but not BSA directly bound to UPIa. upk1a-sftpd-1 1 4 inhibitor inhibitor unspecified role unspecified role 3 unspecified role unspecified role bait bait purified purified c terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role prey prey purified purified human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 7B As shown in Fig. 7B, SP-D but not BSA directly bound to UPIa. The interaction was inhibited by 0.2 M mannose (Fig. 7B). upk1a-fimh-1 1 3 unspecified role unspecified role bait bait purified purified c terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 7B In addition, we analyzed FimH binding to UPIa captured by the anti-FLAG antibody. We confirmed that FimH-RBD but not BSA directly bound to UPIa (Fig. 7C). upk1a-fimh-2 1 2 competitor competitor competitor prey prey purified purified 3 unspecified role unspecified role bait bait purified purified c terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7D Preincubation of SP-D with UPIa significantly decreased the binding of FimH-RBD to UPIa (Fig. 7D).