matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. Journal of cellular biochemistry 2017 imex curation Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-zr-75-1 Human zr-75-1 breast carcinoma cells zr-75-1 ZR-75-1, Human breast ductal carcinoma cell line. Reported to express the oestrogen and progesterone receptors. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu Accepted 2017-JUN-26 AT 10:55 BST AT 10:55 BST by ORCHARD Journal of cellular biochemistry 2017 Only protein-protein interactions imex curation imex curation The Flag-UXT construct was kindly provided by Mark I. Greene (U. Pennsylvania, Philadelphia, PA) [Zhao et al., 2005] (cf. page 2, paragraph Constructs). In Zhao et al., 2005 the construct is described as follows: To generate pcDNA3-FLAG:UXT, full-length UXT was subcloned from the clone isolated from yeast two-hybrid screening by digestion with EcoRI and XbaI and ligation to the pcDNA3 vector (Invitrogen) that contains two FLAG tag sequences between the HindIII/EcoRI sites. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. Journal of cellular biochemistry 2017 imex curation Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu Accepted 2017-JUN-26 AT 10:55 BST AT 10:55 BST by ORCHARD Journal of cellular biochemistry 2017 Only protein-protein interactions imex curation imex curation The Flag-UXT construct was kindly provided by Mark I. Greene (U. Pennsylvania, Philadelphia, PA) [Zhao et al., 2005] (cf. page 2, paragraph Constructs). In Zhao et al., 2005 the construct is described as follows: To generate pcDNA3-FLAG:UXT, full-length UXT was subcloned from the clone isolated from yeast two-hybrid screening by digestion with EcoRI and XbaI and ligation to the pcDNA3 vector (Invitrogen) that contains two FLAG tag sequences between the HindIII/EcoRI sites. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. Journal of cellular biochemistry 2017 imex curation Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu Accepted 2017-JUN-26 AT 10:55 BST AT 10:55 BST by ORCHARD Journal of cellular biochemistry 2017 Only protein-protein interactions imex curation imex curation The Flag-UXT construct was kindly provided by Mark I. Greene (U. Pennsylvania, Philadelphia, PA) [Zhao et al., 2005] (cf. page 2, paragraph Constructs). In Zhao et al., 2005 the construct is described as follows: To generate pcDNA3-FLAG:UXT, full-length UXT was subcloned from the clone isolated from yeast two-hybrid screening by digestion with EcoRI and XbaI and ligation to the pcDNA3 vector (Invitrogen) that contains two FLAG tag sequences between the HindIII/EcoRI sites. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. Journal of cellular biochemistry 2017 imex curation Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sánchez-Morgan N., Kirsch KH., Trackman PC., Sonenshein GE. gail.sonenshein@tufts.edu Accepted 2017-JUN-26 AT 10:55 BST AT 10:55 BST by ORCHARD Journal of cellular biochemistry 2017 Only protein-protein interactions imex curation imex curation The Flag-UXT construct was kindly provided by Mark I. Greene (U. Pennsylvania, Philadelphia, PA) [Zhao et al., 2005] (cf. page 2, paragraph Constructs). In Zhao et al., 2005 the construct is described as follows: To generate pcDNA3-FLAG:UXT, full-length UXT was subcloned from the clone isolated from yeast two-hybrid screening by digestion with EcoRI and XbaI and ligation to the pcDNA3 vector (Invitrogen) that contains two FLAG tag sequences between the HindIII/EcoRI sites. uxt_human Protein UXT UXT HSPC024 Ubiquitously expressed transcript protein Androgen receptor trapped clone 27 protein protein protein human Homo sapiens Human MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH 94CE14C462DEE308 esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 lyox_human Protein-lysine 6-oxidase LOX Lysyl oxidase protein protein human Homo sapiens Human MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRRDPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGASRAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY DIP protein P28300 original sequence version: 106 6412A78443E03F04 lox-uxt-1 2 5 unspecified role unspecified role prey prey tag tag gal4 ad gal4 activation domain gal4 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeast Saccharomyces cerevisiae Baker's yeast 7 unspecified role unspecified role bait bait Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tag tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tag tag gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig. 1A lox-uxt-2 3 5 unspecified role unspecified role prey prey tag tag vp16 ad vp16 activation domain vp16 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait Binding site Binding site sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tag tag gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1B esr1-uxt-1 4 5 unspecified role unspecified role bait bait tag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range tag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey physical association physical association Fig. 4A uxt-esr1-1 1 5 unspecified role unspecified role bait bait tag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range tag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey physical association physical association Fig. 4A