HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Interactome of E. piscicida and grouper liver proteins reveals strategies of bacterial infection and host immune response. Interactome of E. piscicida and grouper liver proteins reveals strategies of bacterial infection and host immune response. Scientific reports 2017 imex curation Li H., Zhu QF., Peng XX., Peng B. pengb26@sysu.edu.cn 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting antibody detection identification by antibody antibody detection Li H., Zhu QF., Peng XX., Peng B. There are no identifiers available for Epinephelus drummondhayi proteins as used in this publication. Therefore, identifiers from from table 1 are used instead. pengb26@sysu.edu.cn Accepted 2017-AUG-17 AT 11:52 BST AT 11:52 BST by MGT Scientific reports 2017 imex curation Interactome of E. piscicida and grouper liver proteins reveals strategies of bacterial infection and host immune response. Interactome of E. piscicida and grouper liver proteins reveals strategies of bacterial infection and host immune response. Scientific reports 2017 imex curation Li H., Zhu QF., Peng XX., Peng B. pengb26@sysu.edu.cn 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li H., Zhu QF., Peng XX., Peng B. pengb26@sysu.edu.cn Accepted 2017-AUG-17 AT 11:52 BST AT 11:52 BST by MGT Scientific reports 2017 imex curation a0a411h509_9gamm tssC EVK84_12950 protein protein Edwardsiella piscicida Edwardsiella piscicida MSEQNLPESSAAESAALEGGLLDSIIAETRMARSDLEKARARDLLGEWVSEVLSGTVTVSGDVLASIEARIAQIDALLSAQLSAIMHEPAFQKLEGSWRGLHYLVHQSETGTGLKIRMLNVSRADLIRDFKSAAEFDQSALFKKVYEEEYGTFGGAPFAAMIGDYEFSNHPEDLFLLEEISHVAAAAHAPFLSAASAGMFGLDSLTELSIPRDLAKGFDTVEYAKWKSLRQSEDARYIALALPHVLGRLPYGATTVPVESFNFEENVSGKEHGKYLWLNAAYALGTRLTQAYAKYGWCAAIRGAEGGGLVEGLPAHTFTTDDGEVELKCPTEVAITDRREKELAELGFIALTHCKGTDYAAFFSTQSVQKPKEYDSDSANANARISCQLQYIMATSRFAHYLKSMVRDKIGSFMSRSECEYFLNQWISNYVVGSDDAGQDIKAKYPLREARIDVSDIPGKPGFYKAVAYLKPHFQLEGLTASLRLVADLPPPAQG 7528F00704CCDF09 rps16_epico ribosomal protein S16 protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus f6kmg8_epico protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus MVEWTDKERATIQDLFSKIDYDAVGQATLCRCLIVYPWTQRYFAKFGNLYNAAAIMGNADVAKHGSIILHGLDRAMKNMDNIKAAYTDLSTLHSETLHVDPDNFRLLSDCLAIVLAARMGKNFTPEIQATIQKFMAVVVSALGRQYH ED839CB011ECDFFE a0a411h4e3_9gamm EVK84_11575 protein protein Edwardsiella piscicida Edwardsiella piscicida MKKSFCAVSLLISLGAAAPVMAEGQTVSLGYAQAKVADFKNIAGVNLKYRYEWDSPLSLMTSFTYMSGSKAFSESTGLEYSRGNGDLKYYSLAAGPAWRINDSVSVYGLLGVNVNKTTVSAAWRDVWVGGYEEGSLQQTRSKGSLMYGAGLQINPLANWSIDVGYEGSRVDLGGSKHSINGFNLGVGYRF F1B78CAEBA745FC7 a0a411gz19_9gamm Outer membrane protein A ompA Outer membrane porin A EVK84_01060 protein protein Edwardsiella piscicida Edwardsiella piscicida MKKTAIALAVALAGFATVAQAAPKDDTWYVGGKLGWSHFISNSFEDMGTTKSHPNQLGAGAFFGYQANPYLGFEMGYDWLGRMGYTGDVNAKFKSQGVQLAAKLSYPLMDDLDVYTRLGGMVWRSDIHGAADGGDYTSSHDTGVSPLAAIGVEYALNKDWATRLDYQYVNKVGTRSETGARPDNTMLSLGVVYRFGQDEVAAPAPIPAPAPAPVVETKRFTLKSDVLFNFNKYTLKAEGRQALDQLYSQLSSMDPKDGSVVVLGYTDRIGSDQYNLKLSKQRAQTVVDYLVSKGIPADKIAARGMGKADPVTGSTCDNVKPRAALINCLAPDRRVVIEVKGIKEEVSQPQA 32C6B5EF4FC20703 f6kml4_epico protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus MALIRGVFVVAAKRTPFGTYGGVLRDHSATDLAEHAAKAALAAGGVAPELINSVIMGNVMQSSADAPYIARHVGLRCGVPIPVPALTVNRLCGSGFQAIINGAQEICLKESEVVLCGGSESMSQAPYAVRNIRFGTKFGVDLKLEDTLWAGLTDLHIKTPMGITAENLAEKYQITREEVDSYAHQTQQKWKAAHEAGHFTAEIAPIDVKAKKGKVSMAQDEHPRPQTTLEQMAKLPPVFKKGGTVTAANASGVSDGAAAVVIASEDALKEHKLTPLARIVAYHVSGCDPSIMGIGPVPAITGALEKP 45FD185597E9AFC9 a0a034t966_9gamm EVK84_09690 MA13_contig00011-0152 protein protein Edwardsiella piscicida Edwardsiella piscicida MYLIDYNSYRSVKGFSRRVRFLVMHYTAIDFKASVTALTGSSVSAHYLIPDPSEKTYIDAGFKDMRIFNLVDENERAWHAGVSSWSGRSNLNDTAIGIETVNLATENNNIFIFPPYNPEQIEAIKALATNILQRYPDITPTNVVGHSDIAPGRKSDPGAAFPWKALYDAGIGAWYQESTMQNYLAQFSRTQPAKADIIAKLKTYGYDTSDAGTDNGYKNLIRAFQLHFRQKNYDGIADAETAAILYALVDKYFPGK A6835DD99D53DA6B a0a034sxt3_9gamm Peptidoglycan-associated protein EVK84_12105 pal MA13_contig00016-0006 protein protein Edwardsiella piscicida Edwardsiella piscicida MQLNKVLKGLMLVLPIMAVAACSSKKNTNDDQSGMGMGANGMENSSSNLSSDEQARLQMQELQKNNIVYFGLDKYDVTPDYMQELDAHAAFLRSNPSYKVTVEGHTDERGTPEYNIALGERRANAVKMYLQGKGVSADQIDIVSYGKEKPAVLGHDEAAYAKNRRAVLVY 93E16A1513B320FC b9v3v4_epico protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus MSDEGKLFIGGLSFETNEESLAAAFGKYGTIEKVDVIRDKETGRSRGFGFVKYDNCDDAKDALEGMNGKTLDGRAIRVDEAGKGGRSNRGFGSGPRGQRGGFGGRGRGGGYNGERSYDRGYGERSFGNEGRFGGGGGGQYRNSGGYSSYRENRGQGGYGERSGSYRDGYDSYATE E95205316F76B991 anxa4_epico annexin max1 protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus b5t1m2_epico 40S ribosomal protein S26 protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus KKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASVFDSYVLPKLYVKLHYCVSCAIHSKVVRNRSCEARKDRTPPPRFRPAAGAPRAPPKPM 0F32ECE46370C739 gcdh_epico Glutaryl-CoA dehydrogenase protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus a0a411h774_9gamm ompC EVK84_16315 protein protein Edwardsiella piscicida Edwardsiella piscicida MKRNLLAVVIPALLVAGAANAAEIYNKDGNKLDLYGKVDGLHYFSSDSSKDGDQSYVRFGFKGETQINDQLTGYGQWEAQANVNQPESNSSNFFTRLGFAGLKYGNYGSIDYGRNYGVLYDIEGWTDVLPEFGGDTSAQTDNYMAQRANNLATYRNNGFFGLVDGLDFALQYQGKNDGHAYGKDADGSYSWDGAPLSNNAREIQGQNGDGFGMSTTYDLGWGISAGAAYTTSNRTTEQKWSGNQANSNVAGGNKAQSWGAGLKYDANNIYLATMYTETQNMTPFGSTGIANKAKNFEAVAQYQFDFGLRPSIAYLQSKASELNSYNGFNGGKADLVKYVDLGATYYFNKNMSTYVDYKINLLDENDFTRANSINTDDIVALGLVYQF A4D4680079EE874C a0a411h1q8_9gamm EVK84_06180 protein protein Edwardsiella piscicida Edwardsiella piscicida MKAFTKLALFVGLVSGATLANAAGINNTGYYAGAKMGISAEHLFDQKDVNGNGMSNDNKGVGNAGLVFGYNFENQFSLPVRAELDYTFRANATSSHTNDAAETNDSRLGLQTLMVNGYYDIKTGTPFTPYVGAGIGYANVSLKNDMNGDNVQSNSNNFAWSVGTGVIYNVNERLDLDLGYKYLDAGKASAGNSQAKVTTHDVTLGVNYYF 2EEE9E74ADE28A7F f6kmr2_epico protein protein epico Epinephelus coioides Orange-spotted grouper Epinephelus nebulosus EKTGQLMDLSPQNLVDCVTENDGCNGGYMTNAFKYVVDNEGIDSEEAYPYIGQDQPCRYNSTGMAAQCKDYKEVPEGNEHALAIALFKHGPVSVGIDATLSSFQFYTKGVYYDRNCNKEDINHAVLAVGFGQNTKGKKYWIVKNSWGDTWGNKGYIMMARNRDNLCGIASLASFPVM 21E876F592A6314A etae_1826--1 1 8 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A etae_1826-gcdh-1 1 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A etae_1267-gcdh-1 1 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A etae_0245-gcdh-1 1 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A anxa4-evpb-1 1 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A anxa4-etae-1826 1 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A anxa4-ompa-1 1 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A evpb-ctsk-1 1 17 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cstk-etae-1826 1 17 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cstk-etae-1267 1 17 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cstk-etae-3048 1 17 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cstk-etae-0245 1 17 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cstk-etae-2675 1 17 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cstk-etae-2572 1 17 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cirbp-evpb-1 1 11 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cirbp-etae-1826 1 11 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A cirbp-ompa-1 1 11 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A hbbe2-ompa-1 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A hbbe2-etae-1826 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A hbbe2-evpb-1 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A hbbe2-etae-3048 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A hbbe2-etae-2675 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A hbbe2-etae-2572 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rps16-ompa-1 1 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rps16-evpb-1 1 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rps16-etae-3048 1 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rps16-etae-2675 1 4 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rps26-etae-1826 1 13 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rps26-etae-3048 1 13 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rsp26-ompa-1 1 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A rps26-etae-2572 1 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A ighm-evpb-1 1 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A ighm-etae-3048 1 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A ighm-ompa-1 1 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A ighm-etae-2675 1 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A fmo-etae-2675 1 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A fmo-etae-2572 1 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A fmo-etae-0245 1 16 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A fmo-etae-3048 1 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A fmo-ompa-1 1 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A fmo-etae-1826 1 15 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A a0a1d7va87_9gamm-fmo-1 1 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A evpb-evpb-1 2 17 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association 5B cstk-etae-1 2 17 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association 5B cstk-etae-2 2 17 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association 5B