IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Stalk Domain of NKp30 Contributes to Ligand Binding and Signaling of a Preassembled NKp30-CD3ζ Complex. The Stalk Domain of NKp30 Contributes to Ligand Binding and Signaling of a Preassembled NKp30-CD3ζ Complex. The Journal of Biological Chemistry 2016 imex curation Memmer S., Weil S., Beyer S., Zöller T., Peters E., Hartmann J., Steinle A., Koch J. Results obtained using chimeric molecules have not been entered as they are of NO biological relevance. pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. (and Bicini -2013) joachim.koch@uni-mainz.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Memmer S., Weil S., Beyer S., Zöller T., Peters E., Hartmann J., Steinle A., Koch J. Results obtained using chimeric molecules have not been entered as they are of NO biological relevance. pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. (and Bicini -2013) joachim.koch@uni-mainz.de Accepted 2017-AUG-04 AT 09:53 BST AT 09:53 BST by ORCHARD The Journal of Biological Chemistry 2016 imex curation The Stalk Domain of NKp30 Contributes to Ligand Binding and Signaling of a Preassembled NKp30-CD3ζ Complex. The Stalk Domain of NKp30 Contributes to Ligand Binding and Signaling of a Preassembled NKp30-CD3ζ Complex. The Journal of Biological Chemistry 2016 imex curation Memmer S., Weil S., Beyer S., Zöller T., Peters E., Hartmann J., Steinle A., Koch J. Results obtained using chimeric molecules have not been entered as they are of NO biological relevance. pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. (and Bicini -2013) joachim.koch@uni-mainz.de 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Memmer S., Weil S., Beyer S., Zöller T., Peters E., Hartmann J., Steinle A., Koch J. Results obtained using chimeric molecules have not been entered as they are of NO biological relevance. pmid:27754869 memmer-2016 and pmid:22807449-Hartmann 2012 and pmid:24275655 Herrmann 2014 are all in the same group. (and Bicini -2013) joachim.koch@uni-mainz.de Accepted 2017-AUG-04 AT 09:53 BST AT 09:53 BST by ORCHARD The Journal of Biological Chemistry 2016 imex curation nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG DIP protein O14931 original sequence version: 110 2855AE4D6902D429 p46379-2 Large proline-rich protein BAG6 BAG6 BAG family molecular chaperone regulator 6 BAT3 BCL2-associated athanogene 6 G3 HLA-B-associated transcript 3 Protein G3 Protein Scythe protein protein human Homo sapiens Human MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP 8A67290BC8176ABA nr3l1_human Natural cytotoxicity triggering receptor 3 ligand 1 NCR3LG1 B7 homolog 6 B7H6 protein protein human Homo sapiens Human MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDAPILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ DIP protein Q68D85 original sequence version: 74 433CE0B0EE0A4470 ncr3lg1-ncr3-3 1 5 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 3 unspecified role unspecified role prey prey c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O14931:p.Lys129Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:03:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys129ala' Tue Jun 30 16:42:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys129Ala' O14931:p.Glu130Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Wed May 02 20:00:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu130ala' Tue Jun 30 18:24:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu130Ala' O14931:p.His131Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain H A Wed May 02 18:24:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his131ala' Tue Jun 30 16:19:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His131Ala' O14931:p.Pro132Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:15:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro132ala' Tue Jun 30 16:38:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro132Ala' O14931:p.Gln133Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 17:21:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln133ala' Tue Jun 30 18:42:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln133Ala' O14931:p.Leu134Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:38:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu134ala' Tue Jun 30 20:16:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu134Ala' O14931:p.Gly135Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:49:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly135ala' Tue Jun 30 17:45:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly135Ala' O14931:p.Gly137Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A Wed May 02 20:14:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly137ala' Tue Jun 30 19:42:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly137Ala' O14931:p.Thr138Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:14:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr138ala' Tue Jun 30 18:37:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr138Ala' O14931:p.Val139Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A Wed May 02 18:48:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val139ala' Tue Jun 30 18:19:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val139Ala' O14931:p.Leu140Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:44:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu140ala' Tue Jun 30 19:16:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu140Ala' O14931:p.Leu141Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:23:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu141ala' Tue Jun 30 17:41:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu141Ala' O14931:p.Leu142Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:36:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu142ala' Tue Jun 30 17:07:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu142Ala' O14931:p.Arg143Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 19:35:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143ala' Tue Jun 30 19:48:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Supp Fig 3, Table 1 I cannot see anything to indicate that B7-H6 is NOT full length Therefore, binding of 14 alanine mutants of NKp30-Fc fusion proteins to immobilized biotinylated B7-H6-Fc fusion proteins was analyzed by surface plasmon resonance bag6-ncr3-11 2 4 unspecified role unspecified role bait bait c_terminus_his_or_strep ii_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range stalk sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O14931:p.Lys129Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:58:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys129ala' Tue Jun 30 18:13:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys129Ala' O14931:p.Glu130Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A Wed May 02 19:21:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu130ala' Tue Jun 30 15:41:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu130Ala' O14931:p.His131Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain H A Wed May 02 18:24:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his131ala' Tue Jun 30 16:09:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His131Ala' O14931:p.Pro132Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Wed May 02 20:10:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro132ala' Tue Jun 30 19:42:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro132Ala' O14931:p.Gln133Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 20:07:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln133ala' Tue Jun 30 16:55:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln133Ala' O14931:p.Leu134Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:04:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu134ala' Tue Jun 30 15:51:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu134Ala' O14931:p.Gly135Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:18:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly135ala' Tue Jun 30 18:44:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly135Ala' O14931:p.Gly137Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:04:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly137ala' Tue Jun 30 18:03:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly137Ala' O14931:p.Thr138Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:47:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr138ala' Tue Jun 30 16:01:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr138Ala' O14931:p.Val139Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A Wed May 02 16:43:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val139ala' Tue Jun 30 19:45:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val139Ala' O14931:p.Leu140Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:39:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu140ala' Tue Jun 30 18:52:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu140Ala' O14931:p.Leu141Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:00:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu141ala' Tue Jun 30 15:40:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu141Ala' O14931:p.Leu142Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:41:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu142ala' Tue Jun 30 20:12:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu142Ala' O14931:p.Arg143Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:26:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg143ala' Tue Jun 30 16:25:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg143Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Supp Table 1 Bicini-2013 -expt 6 (already in IntAct) uses both tags - not specified here which. Interestingly, most of the alanine substitutions were tolerated without loss of binding affinity to BAG-6686–936 as indicated by similar KD values of the mutated and wild type NKp30-Fc fusion proteins (supplemental Table S1).