UniProt UniProt http://www.uniprot.org Springing into Action: Reg2 Negatively Regulates Snf1 Protein Kinase and Facilitates Recovery from Prolonged Glucose Starvation in Saccharomyces cerevisiae. Springing into Action: Reg2 Negatively Regulates Snf1 Protein Kinase and Facilitates Recovery from Prolonged Glucose Starvation in Saccharomyces cerevisiae. Applied and environmental microbiology 2016 imex curation Maziarz M., Shevade A., Barrett L., Kuchin S. skuchin@uwm.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maziarz M., Shevade A., Barrett L., Kuchin S. skuchin@uwm.edu Accepted 2017-SEP-05 AT 10:42 BST AT 10:42 BST by MGT Applied and environmental microbiology 2016 imex curation Springing into Action: Reg2 Negatively Regulates Snf1 Protein Kinase and Facilitates Recovery from Prolonged Glucose Starvation in Saccharomyces cerevisiae. Springing into Action: Reg2 Negatively Regulates Snf1 Protein Kinase and Facilitates Recovery from Prolonged Glucose Starvation in Saccharomyces cerevisiae. Applied and environmental microbiology 2016 imex curation Maziarz M., Shevade A., Barrett L., Kuchin S. skuchin@uwm.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Maziarz M., Shevade A., Barrett L., Kuchin S. skuchin@uwm.edu Accepted 2017-SEP-05 AT 10:42 BST AT 10:42 BST by MGT Applied and environmental microbiology 2016 imex curation snf1_yeast Carbon catabolite-derepressing protein kinase SNF1 CAT1 CCR1 GLC2 PAS14 Sucrose nonfermentating protein 1 D8035.20 YDR477W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEKDEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQSKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVSNISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN F5C63565C986C4E3 F5C63565C986C4E3 reg2_yeast Protein REG2 YBR0504 YBR050C REG2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTLSNCDSLDNLFQDPPEEEESSKFVEAVRTLMNRNDMGYPPAAANGTYCLKKIKSLNAKQWKINKKRMCMLPAVKKKNFDFHEQRSLILNLNLWKFIKFINCSSKNNYNKNNKHVRSSNNTVKNENVLPLQKHKKVDNDQRLENLFWRSWFKARKRRDIMGKPRERHIKFNDNVEQCIITDEHFIQRLPSTRLNSTDEQRPCSKSELDPCIGNAASKRSFYDYNSVYVASDAIITTAAATAIISSNSGDYQRGHDVRDVPRNVLLQAGETDFSSVLRVDSDLKLSNISHHSPVKPSSTSSHSTFIFESETDTDTDTDAETENDIDAYIDTSIPNLLL 60A26FDE19ED36F7 pp12_yeast Serine/threonine-protein phosphatase PP1-2 GLC7 CID1 DIS2 YER133W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKSLPRQAGGRKKK 71B20E3A4ED93235 71B20E3A4ED93235 snf1-reg2-1 1 4 unspecified role unspecified role prey prey P38232:p.[Ile169Met;Phe171Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I M certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:24:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile169met,phe171ala' Tue Jun 30 17:09:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile169Met;Phe171Ala]' 3 unspecified role unspecified role bait bait P06782:p.Lys84Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:14:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys84arg' Tue Jun 30 16:47:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys84Arg' P06782:p.Thr210Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:51:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr210ala' Tue Jun 30 19:13:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr210Ala' physical association physical association Fig. 1A, 2A, 6F The interaction was stronger under glucose-limiting conditions reg2-snf1-1 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Fig. 1A The interaction was stronger under glucose-limiting conditions Thus, these experiments indicated that Reg2 and Snf1 interact in the two-hybrid system in a glucose-regulated manner. reg2-snf1-2 2 4 unspecified role unspecified role unspecified role unspecified role n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role unspecified role unspecified role thr-210 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm P06782:p.Thr210Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:35:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr210ala' Tue Jun 30 19:12:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr210Ala' physical association physical association Fig. 2C We further examined the interaction between Reg2 and nonphosphorylatable Snf1-T210A by coimmunoprecipitation. glc7-reg2-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey P38232:p.[Ile169Met;Phe171Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I M certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:50:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile169met,phe171ala' Tue Jun 30 17:42:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile169Met;Phe171Ala]' physical association physical association wild-type Reg2 interacted strongly with Glc7 in the yeast two-hybrid system (Fig. 6B). Fig 6B