DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. Nature cell biology 2016 imex curation Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. DIP original experiment: DIP-268995X Nature cell biology 2016 IMEx A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. Nature cell biology 2016 imex curation Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. DIP original experiment: DIP-268994X Nature cell biology 2016 IMEx A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. Nature cell biology 2016 imex curation Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. DIP original experiment: DIP-268992X Nature cell biology 2016 IMEx A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. Nature cell biology 2016 imex curation Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. DIP original experiment: DIP-268993X Nature cell biology 2016 IMEx A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. Nature cell biology 2016 imex curation Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Li X., Qian X., Peng LX., Jiang Y., Hawke DH., Zheng Y., Xia Y., Lee JH., Cote G., Wang H., Wang L., Qian CN., Lu Z. DIP original experiment: DIP-268991X Nature cell biology 2016 IMEx A splicing switch from ketohexokinase-C to ketohexokinase-A drives hepatocellular carcinoma formation. prps1_human Ribose-phosphate pyrophosphokinase 1 Phosphoribosyl pyrophosphate synthase I PRPS1 PPRibP protein protein human Homo sapiens Human MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL DIP protein P60891 original sequence version: 139 46D017E969908BA0 p50053-2 Ketohexokinase KHK Hepatic fructokinase Peripheral protein protein human Homo sapiens Human MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV More widely distributed but with a low expression level. KM=7 mM for D-fructose (at 25 degrees Celsius). KM=036 mM for Mg-ATP (at 25 degrees Celsius). kcat is 6.9 sec(-1). DIP protein P50053-2 original sequence version: 157 1BA47BDC60C1B89F p60891-1 Ribose-phosphate pyrophosphokinase 1 PRPS1 PPRibP Phosphoribosyl pyrophosphate synthase I protein protein human Homo sapiens Human MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL DIP protein P60891-1 original sequence version: 139 prps1-khk-1 4 8 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction khk-prps1-1 5 6 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association khk-prps1-2 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role pT225 pT225 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain Resulting PTM P60891-1:p.Thr225Ala T225A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T225A'. Wed May 02 19:37:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr225ala' Tue Jun 30 15:41:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr225Ala' pT225 pT225 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain Resulting PTM ecolx Escherichia coli 7 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation khk-prps1-3 3 8 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P50053-2:p.Leu83Ala L83A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L83A'. Wed May 02 17:43:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu83ala' Tue Jun 30 19:25:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu83Ala' ecolx Escherichia coli direct interaction direct interaction khk-prps1-4 2 8 enzyme target enzyme target substrate substrate unspecified role unspecified role pT225 pT225 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain Resulting PTM pT225 pT225 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain Resulting PTM ecolx Escherichia coli 7 enzyme enzyme unspecified role unspecified role P50053-2:p.Leu83Ala L83A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L83A'. Wed May 02 18:26:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu83ala' Tue Jun 30 18:17:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu83Ala' P50053-2:p.Gly257Arg G257R mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G R This feature has been corrected as a result of our quality control procedures. The original label was 'G257R'. Wed May 02 18:22:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly257arg' Tue Jun 30 15:39:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly257Arg' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation