DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Nature structural & molecular biology 2016 imex curation Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268901X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Nature structural & molecular biology 2016 imex curation Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268897X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Nature structural & molecular biology 2016 imex curation Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268896X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Nature structural & molecular biology 2016 imex curation Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268898X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Nature structural & molecular biology 2016 imex curation Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268900X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Nature structural & molecular biology 2016 imex curation Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268899X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. Nature structural & molecular biology 2016 imex curation Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Lu A., Li Y., Schmidt FI., Yin Q., Chen S., Fu TM., Tong AB., Ploegh HL., Mao Y., Wu H. DIP original experiment: DIP-268895X Nature structural & molecular biology 2016 IMEx Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism. car17_human Caspase recruitment domain-containing protein 17 CARD17 INCA Caspase-1 inhibitor INCA Inhibitory caspase recruitment domain protein protein protein human Homo sapiens Human MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS DIP protein Q5XLA6 original sequence version: 87 casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH DIP protein P29466 original sequence version: 155 DIP protein P29466-1 original sequence version: 169 DIP protein P29466 original sequence version: 169 DIP protein P29466 original sequence version: 163 DIP protein P29466 original sequence version: 101 DIP protein P29466 original sequence version: 160 DIP protein P29466 original sequence version: 184 ABF33CF33CC71584 car18_human Caspase recruitment domain-containing protein 18 CARD18 ICEBERG UNQ5804/PRO19611 Caspase-1 inhibitor Iceberg protein protein human Homo sapiens Human MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH DIP protein P57730 original sequence version: 114 casp1-1 7 9 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction casp1-card17-1 4 8 unspecified role unspecified role prey prey Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association card18-casp1-1 5 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction card17-casp1-1 3 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction casp1-card18-1 1 10 unspecified role unspecified role prey prey Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction card18-casp1-2 6 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction card17-casp1-2 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 1-95 Region 1-95 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction