DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Nature structural & molecular biology 2016 imex curation Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268905X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Nature structural & molecular biology 2016 imex curation Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268904X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Nature structural & molecular biology 2016 imex curation Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268902X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Nature structural & molecular biology 2016 imex curation Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268903X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. Nature structural & molecular biology 2016 imex curation Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. Only protein-protein interactions in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Tasselli L., Xi Y., Zheng W., Tennen RI., Odrowaz Z., Simeoni F., Li W., Chua KF. DIP original experiment: DIP-268906X Nature structural & molecular biology 2016 IMEx SIRT6 deacetylates H3K18ac at pericentric chromatin to prevent mitotic errors and cellular senescence. h3(1027) Histone 3 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) STGGKAPRKQLATKAARK tif1b_human Transcription intermediary factor 1-beta TRIM28 KAP1 RNF96 TIF1B Tripartite motif-containing protein 28 Nuclear corepressor KAP-1 KRAB-associated protein 1 KRAB-interacting protein 1 RING finger protein 96 E3 SUMO-protein ligase TRIM28 RING-type E3 ubiquitin transferase TIF1-beta protein protein human Homo sapiens Human MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAGTPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP DIP protein Q13263 original sequence version: 156 DIP protein Q13263 original sequence version: 154 DIP protein Q13263-1 original sequence version: 143 DIP protein Q13263 original sequence version: 198 DIP protein Q13263 original sequence version: 155 2027BABB7C94FE20 af9_human Protein AF-9 ALL1-fused gene from chromosome 9 protein Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein YEATS domain-containing protein 3 MLLT3 AF9 YEATS3 protein protein human Homo sapiens Human MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS DIP protein P42568 original sequence version: 135 DIP protein P42568 original sequence version: 103 DIP protein P42568 original sequence version: 136 0A020B7FB34132F9 sir6_human NAD-dependent protein deacetylase sirtuin-6 SIR2-like protein 6 SIRT6 SIR2L6 Regulatory protein SIR2 homolog 6 protein protein human Homo sapiens Human MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS DIP protein Q8N6T7 original sequence version: 100 DIP protein Q8N6T7-1 original sequence version: 105 DIP protein Q8N6T7 original sequence version: 137 0C86AAC497130BBF cenpa_human Histone H3-like centromeric protein A CENPA Centromere autoantigen A Centromere protein A protein protein human Homo sapiens Human MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG DIP protein P49450 original sequence version: 101 DIP protein P49450 original sequence version: 153 DIP protein P49450 original sequence version: 162 11A28FEB54486489 sirt6-cenpa-1 3 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association h3(1027)-trim28-1 2 7 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain PTM disrupting an interaction Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal in vitro In vitro direct interaction direct interaction h3(1027)-sirt6-1 5 9 enzyme enzyme unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 enzyme target enzyme target substrate substrate unspecified role unspecified role K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain in vitro In vitro deacetylation deacetylation reaction deacetylation h3(1027)-trim28-2 4 7 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain PTM disrupting an interaction Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal in vitro In vitro physical association physical association h3(1027)-mllt3-1 1 8 unspecified role unspecified role prey prey Region 1-138 Region 1-138 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role bait bait K9ac K9ac naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain Prerequisite-PTM Biotin-tag Biotin-tag biotin tag biotin tag n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal in vitro In vitro direct interaction direct interaction