DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Nature structural & molecular biology 2016 imex curation Tuttle MD., Comellas G., Nieuwkoop AJ., Covell DJ., Berthold DA., Kloepper KD., Courtney JM., Kim JK., Barclay AM., Kendall A., Wan W., Stubbs G., Schwieters CD., Lee VM., George JM., Rienstra CM. Only protein-protein interactions in vitro In vitro solid state nmr solid state nmr ssnmr solid state nmr predetermined predetermined participant predetermined Tuttle MD., Comellas G., Nieuwkoop AJ., Covell DJ., Berthold DA., Kloepper KD., Courtney JM., Kim JK., Barclay AM., Kendall A., Wan W., Stubbs G., Schwieters CD., Lee VM., George JM., Rienstra CM. DIP original experiment: DIP-268907X Nature structural & molecular biology 2016 IMEx Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Nature structural & molecular biology 2016 imex curation Tuttle MD., Comellas G., Nieuwkoop AJ., Covell DJ., Berthold DA., Kloepper KD., Courtney JM., Kim JK., Barclay AM., Kendall A., Wan W., Stubbs G., Schwieters CD., Lee VM., George JM., Rienstra CM. Only protein-protein interactions in vitro In vitro x-ray fiber diffrac x-ray fiber diffraction X-ray X-ray x-ray fiber diffrac predetermined predetermined participant predetermined Tuttle MD., Comellas G., Nieuwkoop AJ., Covell DJ., Berthold DA., Kloepper KD., Courtney JM., Kim JK., Barclay AM., Kendall A., Wan W., Stubbs G., Schwieters CD., Lee VM., George JM., Rienstra CM. DIP original experiment: DIP-268909X Nature structural & molecular biology 2016 IMEx Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. Nature structural & molecular biology 2016 imex curation Tuttle MD., Comellas G., Nieuwkoop AJ., Covell DJ., Berthold DA., Kloepper KD., Courtney JM., Kim JK., Barclay AM., Kendall A., Wan W., Stubbs G., Schwieters CD., Lee VM., George JM., Rienstra CM. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Tuttle MD., Comellas G., Nieuwkoop AJ., Covell DJ., Berthold DA., Kloepper KD., Courtney JM., Kim JK., Barclay AM., Kendall A., Wan W., Stubbs G., Schwieters CD., Lee VM., George JM., Rienstra CM. DIP original experiment: DIP-268908X Nature structural & molecular biology 2016 IMEx Solid-state NMR structure of a pathogenic fibril of full-length human α-synuclein. p37840-1 Alpha-synuclein NACP140 SNCA NACP PARK1 Non-A beta component of AD amyloid Non-A4 component of amyloid precursor protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840-1 original sequence version: 101 DIP protein P37840-1 original sequence version: 192 6BB2F12128931663 snca-9 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction snca-10 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction snca-11 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction