DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. Nature cell biology 2016 imex curation Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. DIP original experiment: DIP-268961X Nature cell biology 2016 IMEx A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. Nature cell biology 2016 imex curation Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. DIP original experiment: DIP-268959X Nature cell biology 2016 IMEx A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. Nature cell biology 2016 imex curation Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. DIP original experiment: DIP-268960X Nature cell biology 2016 IMEx A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. Nature cell biology 2016 imex curation Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li X., Rydzewski N., Hider A., Zhang X., Yang J., Wang W., Gao Q., Cheng X., Xu H. DIP original experiment: DIP-268958X Nature cell biology 2016 IMEx A molecular mechanism to regulate lysosome motility for lysosome positioning and tubulation. pdcd6_human Programmed cell death protein 6 PDCD6 ALG2 Apoptosis-linked gene 2 protein homolog protein protein human Homo sapiens Human MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV DIP protein O75340 original sequence version: 73 DIP protein O75340 original sequence version: 154 D0B5944CF3C696AD dctn2_human Dynactin subunit 2 Dynactin complex 50 kDa subunit 50 kDa dynein-associated polypeptide p50 dynamitin DCTN2 DCTN50 protein protein human Homo sapiens Human MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK DIP protein Q13561 original sequence version: 155 DIP protein Q13561 original sequence version: 160 C2FF01A9739337B2 pdcd6-dctn2-1 3 6 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association dctn2-pdcd6-1 4 5 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association dctn2-pdcd6-2 1 5 unspecified role unspecified role prey prey mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association pdcd6-dctn2-2 2 5 unspecified role unspecified role bait bait mCherry-tag mCherry-tag mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association