UniProt UniProt http://www.uniprot.org Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Is a Selective Allosteric Antagonist of α7 Nicotinic Acetylcholine Receptor. Human Secreted Ly-6/uPAR Related Protein-1 (SLURP-1) Is a Selective Allosteric Antagonist of α7 Nicotinic Acetylcholine Receptor. PloS one 2015 imex curation Lyukmanova EN., Shulepko MA., Kudryavtsev D., Bychkov ML., Kulbatskii DS., Kasheverov IE., Astapova MV., Feofanov AV., Thomsen MS., Mikkelsen JD., Shenkarev ZO., Tsetlin VI., Dolgikh DA., Kirpichnikov MP. ekaterina-lyukmanova@yandex.ru 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Lyukmanova EN., Shulepko MA., Kudryavtsev D., Bychkov ML., Kulbatskii DS., Kasheverov IE., Astapova MV., Feofanov AV., Thomsen MS., Mikkelsen JD., Shenkarev ZO., Tsetlin VI., Dolgikh DA., Kirpichnikov MP. Mapping of alpha-Bungarotoxin according supplier. Recombinant SLURP-2 described in PMID 25558396. Recombinant SLURP-1 described in PMID 23581991 ekaterina-lyukmanova@yandex.ru Accepted 2017-NOV-23 AT 11:03 GMT AT 11:03 GMT by ORCHARD PloS one 2015 imex curation slur2_human Secreted Ly-6/uPAR domain-containing protein 2 SLURP2 Secreted LY6/PLAUR domain-containing protein 2 Secreted Ly-6/uPAR-related protein 2 protein protein human Homo sapiens Human MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD 81719A103EC3001A slur1_human Secreted Ly-6/uPAR-related protein 1 ARS ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein SLURP1 protein protein human Homo sapiens Human MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL 07AAF6BCA8031282 3l21a_bunmu Alpha-bungarotoxin Long neurotoxin 1 Alpha-bungarotoxin, isoform A31 Alpha-elapitoxin-Bm2a protein protein bunmu Bungarus multicinctus Many-banded krait MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG mint Produces peripheral paralysis by blocking neuromuscular transmission at the postsynaptic site. Binds to muscular and neuronal (alpha-7, alpha-8, and alpha-9) nicotinic acetylcholine receptors. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM) 589B26743ABBA5E4 acha7_human Neuronal acetylcholine receptor subunit alpha-7 CHRNA7 NACHRA7 protein protein human Homo sapiens Human MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA D94B3A482EAA0E42 slurp1-chrna7-1 1 5 unspecified role unspecified role prey prey human-brain-cortex Homo sapiens brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P55000:p.Ala22_Leu23insMet mutation mutation certain certain sequence position certain certain certain sequence position certain AL AML Wed May 02 20:20:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu23met_leu' Wed Jun 13 18:48:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu23insMet' Tue Jun 30 16:26:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala22_Leu23insMet' ecoli Escherichia coli (strain K12) physical association physical association 2 slurp1-chrna7-2 1 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection rat-gh4c1 Rat pituitary tumor GH4C1 cells gh4c1 pituitary tumor GH4C1 cells 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P55000:p.Ala22_Leu23insMet mutation mutation certain certain sequence position certain certain certain sequence position certain AL AML Wed May 02 14:30:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu23met_leu' Tue Jun 30 16:30:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala22_Leu23insMet' ecoli Escherichia coli (strain K12) physical association physical association 4C slurp2-chrna7-1 1 2 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DP57:p.Ala22_Ile23insMet mutation mutation certain certain sequence position certain certain certain sequence position certain AI AMI Wed May 02 19:57:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile23met_ile' Tue Jun 30 19:23:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala22_Ile23insMet' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection rat-gh4c1 Rat pituitary tumor GH4C1 cells gh4c1 pituitary tumor GH4C1 cells physical association physical association 4C 3l21a_bunmu-chrna7-1 1 4 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection rat-gh4c1 Rat pituitary tumor GH4C1 cells gh4c1 pituitary tumor GH4C1 cells physical association physical association 4C