DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268710X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268717X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268714X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268707X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268712X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268709X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268711X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268716X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268713X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268715X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Crystal structure of eukaryotic translation initiation factor 2B. Nature 2016 imex curation Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kashiwagi K., Takahashi M., Nishimoto M., Hiyama TB., Higo T., Umehara T., Sakamoto K., Ito T., Yokoyama S. DIP original experiment: DIP-268708X Nature 2016 IMEx Crystal structure of eukaryotic translation initiation factor 2B. c4qxj0_kompg PAS_chr1-4_0135 protein protein picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris MSEEITKTEALGFDPTLKKKKKKAKSADPEVLEQSVDTKEGDDDLFSGLKKKKKKATAATGEEKEVEKDLADVMGELKLKKKKKKAAAPVSEDFDKLLEKAGVLEDDKDVTKESTPEVETTTDLGPKYEDMLSRFFKVLKQNNPELAGERSGPKFRIPPPVVQREGTKRTLFANVQEIATVLQRSPEHLIQYLFAELGTSGSIDGQKRLIIKGRFQPKQIENVLRRYIIEYVTCKTCKSMNTELKRESANRLHFIVCKACGSTKSVSSIKTGFQAHVGRRRKM DIP protein C4QXJ0 original sequence version: 40 if2a_schpo Eukaryotic translation initiation factor 2 subunit alpha tif211 SPAC3G9.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSTTSCRMYENRFPEVDELVVVNVRQIQEMGAYVKLLEYDNIEGMVLLSELSRRRIRSVQKHIRVGRNEVVVVLRVDKEKGYIDLSKRRVSPEDVVKCEERFNKSKAVHSIMRHIAEKHNVPLETMYTTIGWPLYRKYGHAYDAFKLAISNPDHVFEGLEPPKSGVINDLLAQISRRLTPQPIKIRADVEVTCFGYEGINAIKAALKAAEDVHTEEVPIKVKLVAPPLYVLLTNALDKSLGLKKLEEAIGAIEKSITASNGTCTVKMKPKAVSETDELELADLMKKFEKENAEISGDEEDDQSGSE 6C967FF2C3BD0D1E c4r3h4_kompg PAS_chr3_0077 protein protein picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris MSTSTCRFYENKYPEVDDVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIQKLIRVGKNEVVVVLRVDKEKGYIDLSKRRVSSEDIAKCEERYTKSKSVHSILRHCAEKFNMPLEELYRTIGWPLSKEFGHAYDAFKISITDSTVFDKVQPPSQEVLEELKVYISRRLTPQAIKCRADVEVSCFSYEGIEAIKSSLKAAEDISTEANQVKVKLVAAPLYVITTQSLDKTQGIEILERAIKIIEDSITKQGGSCNVTMAPKAVTATEDAELQALMERKENEDKVSDEDSDLDEED DIP protein C4R3H4 original sequence version: 43 ei2bb_schpo Probable translation initiation factor eIF-2B subunit beta tif222 eIF-2B GDP-GTP exchange factor subunit beta SPAC343.14c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSTINVEHTYPAVSSLIADLKSRKVQGPFAVAVETALVMRQVISQTRWSTVDQLIDTVRAVGSTLVKAQPTEFSCGNIIRRILRLIREEYQELLKTADENEKLIVSSSNSSSPSQKRDIPSNEKLVQSHEPVSVQMYSSMLNLLGRPTLESPTHSKTVGDSRVTGGMDMRAVIISGIQDVIDELDKINTDIEVQSMDHLHSNEIILTQGCSKTVEAFLRFAAKKRKFSVIVAEGFPNNQKGSHAMAKRLAQAGIDTTVISDATIFAIMSRVNKVILGTHAILGNGGLVTYSGAQLVAQAARHHATPVVVCSGIYKLSPVYPYDLESIIQLSSPDKIMSFNEGDLISRAEILNPYYDYIPPDLVDLFITNLGGYPPSYLYRIMNDTYDASDTIL 19F324EF0135628B ei2bg_schpo Probable translation initiation factor eIF-2B subunit gamma tif223 eIF-2B GDP-GTP exchange factor subunit gamma SPAC4D7.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSLYEHAALPLASSPSILGPISGGRNRGNIQLQSIPIEFQAVVFAGFGNSLYPLTGSDALPKALLPIGNKPMLHYPLYWLEAAGFTSAILICMEEAEAHINAWLRSGYEGHMRIHVEAPTILDDSKSSADALRAVSHLIKNDFVCLSCDSIVGLPPIYGLDKFRLDNPSALAVYSPVLKYEHITSQSKEIDAKQLIGIEEKTSRLLYAKSSADVGSDFTFRMSLLWKHPRVTLNTNLSDAHIFVFKHWVIDLIREKESISSIRGDLIPYLVKCQYQKSFTVRENIQRFLSSPNNIDNYDGGLSSQEIKINALIAKDGIICSRANNLPNYFELNKCIAKLTPEQRLVDVTVSERALVGADCMVNEGTTIKDNSNIKKSIIGKNCVIGKGVVVSNSILMDNIVVEDGVRLESCIVASGAQIGAKSKLRECEIGVDHRVEAGRIARGERLVDMEKIETDMD 242987543BE43021 ei2ba_schpo Translation initiation factor eIF-2B subunit alpha tif221 SPCC11E10.07c eIF-2B GDP-GTP exchange factor subunit alpha protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVESDSSGIVRHSQGEFDIVQVYKKFLQDDPEITMPVAAIEALVQLLSRSQAKTISEFMDILQNGSNTLKEGVQNNISLSAGCDIFQRFVTRSLHDVGDFEQCKRHLVENGKLFIQRARACRQRIAHLGYPLIRDGSVILTHGFSRGVAAVLLAAAKRHVRFKVFVTESRPSGSGCLMTRTLKNACIPTCMVLDSAVSFTMNRVDLVLVGAEGVVENGGLINQIGTFQLAVFAKHAHKPFYAVAESHKFVRMFPLSQYDIPFSRPILEFDDPSPETVHPEPEPIPTPSDAIHNELIMNEEQIRNNPTLDVTPPEFVSGLITDLGIIDSKSGVSEELIKLYL 6FAACEBEBD50995A 6FAACEBEBD50995A ei2bd_schpo Probable translation initiation factor eIF-2B subunit delta tif224 eIF-2B GDP-GTP exchange factor subunit delta SPAC21E11.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGFSAEQAKKDGKDQSPVSESSSVGGTSPATASSVVSPNEPKLSGKEAKALKKARKQASRRAKAEAAAANNPPGVSEEKKVAIPNKNSNQQKKASKQNPQNSPETDANLQEKKIFEEKQVSIFSHLDWRRRRTTENIPKDIHPAVIRLGLKLANYKIFGSNQRCIDLLKTFKIVIQDYQTPYGTTLSRHLTTHINSQIAYLVSTRPLSISMGNAIRFLKLEISVLDIDLTDDEGKELLLEKIDSYIRDRIIIAGQVIVQAATEKIQDGDVILTYLHSSTVNDVLIHAKNVGKKFRVVVVDSRPEFEGRVCLKLLTEHGIECTYVMISALSYIMQEVTKIFLGGHAMLSNGALYSRAGTSLISLLGHESNVPVIACCESYKFTERIQLDSLVYNELAPGDQLVNMGVDDFEEKPGVLANWKSVKNLKLLSLKYDVTPPRLITVCVCEMGLLPSTSVPAIINEFKQVYA 3C7029EBDFEF6EAF ei2be_schpo Probable translation initiation factor eIF-2B subunit epsilon tif225 eIF-2B GDP-GTP exchange factor subunit epsilon SPAC8C9.15c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPPSKGLNGKLEKPKHALQAIVLSDSYNYRFRPLTLDKPRCLLPLANTPLIEYTFEFLALAGVQEVYVFCCAHAGQIREYIEKSKWNLPSSPFSVNTIVSRESLSVGDALRELDSKQLITSDFILVSGDVVSNVPLNEVLKEHRKRREDDKNAIMTMVVREASPFHRTRARTESSVFVIDKKTSQCVHYQANERGKHYVSMDPEIFNEHEELEVRNDLIDCQIDICSNDVPALFTENFDYQDIRKDFVYGVLTSDLLGKKIHCHVAKENYAARVRSLQTYDAISKDVLSRWVYPFVPDSNLLNQTFSYQRHQIYKEEDVVLARSCIIKARTLIGAYTKVGDASVVANTIIGRNCTIGSNCSIDSAFLWEDVVIGDNCRIGKAILANSVKIGNNCSIEDGAIVAAGVVIGDNTIIEKNKRLTTFESHSQGTLNDPSLVGIGGRGQEYHAEEDSDDEGEFMEASGLIESTNELHLSDSESSETSSSSEEDMEFIPFSARRDSANTINSEDFDEGDFNKEAQQSLERAFEENHQIDIAALELNTLRMAMNANYHEVRSAIVLALLRRIMHLDVSPKEALAKVMTRWGPLLAKLTFSHEEQVDNVLTLQKYCVRLSMTRHFLQLLGYFYQLEIAEENAIQEWYSDPRSSEGELAALRDAGGKQFVDWLNTAESESESEEGSE D399547CBD82C4BC c4r5q4_kompg Protein-synthesizing GTPase PAS_chr3_0839 protein protein picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris MADDLQSQTPDIIIGSTIDDGYEQYATEEEIEEDQTQDLDESKSKKTVSFAELDEVDEEELRKKEFEEGGGLPAQPDNPEFEKLTPLSPEIINRQATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCDNDECPEPDCYRSFKSDREIHPKCQRPGCTGRYNLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLVAGNESCPQPQTSEHLAAIEIMKLNHVIILQNKVDLMREETALEHHKSILKFIRGTIADGAPIVPISAQLKYNIDAVNELIVKTIPVPPRDFTASPRLIVIRSFDVNKPGAEIDELKGGVAGGSILTGVFKIGDEIEVRPGIVTKDDSGKIQCKPIFSSIVSLFAEHNDLKFAVPGGLIGVGTKVDPTLCRADRLVGQVVGAKGHLPSIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLDPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLEPIA DIP protein C4R5Q4 original sequence version: 43 eif2b_alpha-eif2bbeta-1 4 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association eif2bdelta-speif2alpha-1 10 18 unspecified role unspecified role unspecified role unspecified role pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association c4qxj0_kompg-c4r3h4_kompg-1 7 20 unspecified role unspecified role unspecified role unspecified role picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris 12 unspecified role unspecified role unspecified role unspecified role picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris 14 unspecified role unspecified role unspecified role unspecified role picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris physical association physical association c4r5q4_kompg-eif2bepsilon-1 1 20 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris 19 unspecified role unspecified role unspecified role unspecified role pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif2b_alpha-speif2alpha-1 8 17 unspecified role unspecified role unspecified role unspecified role Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association c4r5q4_kompg-eif2bgamma-1 5 16 unspecified role unspecified role unspecified role unspecified role pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris physical association physical association c4qxj0_kompg-c4r3h4_kompg-2 11 20 unspecified role unspecified role unspecified role unspecified role picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris 12 unspecified role unspecified role unspecified role unspecified role picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris 14 unspecified role unspecified role unspecified role unspecified role picpg Komagataella pastoris (strain GS115 / ATCC 20864) Yeast Pichia pastoris 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association eif2b_alpha-eif2bbeta-2 6 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association eif2bbeta-speif2alpha-1 2 15 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association eif2b_alpha-speif2alpha-2 9 17 unspecified role unspecified role unspecified role unspecified role pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association eif2bbeta-speif2alpha-2 3 15 unspecified role unspecified role unspecified role unspecified role pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain pBpa-label pBpa-label unnatural residue unnatural residue certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association