DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268734X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268731X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268735X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268736X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268733X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268752X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268730X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268729X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268737X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268744X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268746X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268741X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268727X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268748X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268745X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268739X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268740X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268747X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268750X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268738X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268742X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268749X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268751X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268743X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268732X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. A receptor heteromer mediates the male perception of female attractants in plants. Nature 2016 imex curation Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang T., Liang L., Xue Y., Jia PF., Chen W., Zhang MX., Wang YC., Li HJ., Yang WC. DIP original experiment: DIP-268728X Nature 2016 IMEx A receptor heteromer mediates the male perception of female attractants in plants. mik1_arath MDIS1-interacting receptor like kinase 1 MIK1 PXL2 Leucine-rich repeat receptor-like protein kinase PXL2 Protein PHLOEM INTERCALATED WITH XYLEM-LIKE 2 T5F17.100 At4g28650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKMKIIVLFLYYCYIGSTSSVLASIDNVNELSVLLSVKSTLVDPLNFLKDWKLSDTSDHCNWTGVRCNSNGNVEKLDLAGMNLTGKISDSISQLSSLVSFNISCNGFESLLPKSIPPLKSIDISQNSFSGSLFLFSNESLGLVHLNASGNNLSGNLTEDLGNLVSLEVLDLRGNFFQGSLPSSFKNLQKLRFLGLSGNNLTGELPSVLGQLPSLETAILGYNEFKGPIPPEFGNINSLKYLDLAIGKLSGEIPSELGKLKSLETLLLYENNFTGTIPREIGSITTLKVLDFSDNALTGEIPMEITKLKNLQLLNLMRNKLSGSIPPAISSLAQLQVLELWNNTLSGELPSDLGKNSPLQWLDVSSNSFSGEIPSTLCNKGNLTKLILFNNTFTGQIPATLSTCQSLVRVRMQNNLLNGSIPIGFGKLEKLQRLELAGNRLSGGIPGDISDSVSLSFIDFSRNQIRSSLPSTILSIHNLQAFLVADNFISGEVPDQFQDCPSLSNLDLSSNTLTGTIPSSIASCEKLVSLNLRNNNLTGEIPRQITTMSALAVLDLSNNSLTGVLPESIGTSPALELLNVSYNKLTGPVPINGFLKTINPDDLRGNSGLCGGVLPPCSKFQRATSSHSSLHGKRIVAGWLIGIASVLALGILTIVTRTLYKKWYSNGFCGDETASKGEWPWRLMAFHRLGFTASDILACIKESNMIGMGATGIVYKAEMSRSSTVLAVKKLWRSAADIEDGTTGDFVGEVNLLGKLRHRNIVRLLGFLYNDKNMMIVYEFMLNGNLGDAIHGKNAAGRLLVDWVSRYNIALGVAHGLAYLHHDCHPPVIHRDIKSNNILLDANLDARIADFGLARMMARKKETVSMVAGSYGYIAPEYGYTLKVDEKIDIYSYGVVLLELLTGRRPLEPEFGESVDIVEWVRRKIRDNISLEEALDPNVGNCRYVQEEMLLVLQIALLCTTKLPKDRPSMRDVISMLGEAKPRRKSNSNEENTSRSLAEKHSSVFSTSPVNGLL DIP protein Q9M0G7 original sequence version: 123 lur12_arath Protein LURE 1.2 LURE1.2 CRP810_1.2 Cysteine-Rich Peptide 810_1.2 Defensin-like protein 213 MWF20.23 At5g43510 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLPIIFLTLLIFVSSCTSTLINGSSDEERTYSFSPTTSPFDPRSLNQELKIGRIGYCFDCARACMRRGKYIRTCSFERKLCRCSISDIK DIP protein Q4VP08 original sequence version: 43 mik2_arath MDIS1-interacting receptor like kinase 2 MIK2 Probable LRR receptor-like serine/threonine-protein kinase At4g08850 T32A17.160 At4g08850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNKTNPERKISLTSFKERMACKEKPRDLQVLLIISIVLSCSFAVSATVEEANALLKWKSTFTNQTSSSKLSSWVNPNTSSFCTSWYGVACSLGSIIRLNLTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNLQGPIPDNAAFRNAPPDAFEGNKDLCGSVNTTQGLKPCSITSSKKSHKDRNLIIYILVPIIGAIIILSVCAGIFICFRKRTKQIEEHTDSESGGETLSIFSFDGKVRYQEIIKATGEFDPKYLIGTGGHGKVYKAKLPNAIMAVKKLNETTDSSISNPSTKQEFLNEIRALTEIRHRNVVKLFGFCSHRRNTFLVYEYMERGSLRKVLENDDEAKKLDWGKRINVVKGVAHALSYMHHDRSPAIVHRDISSGNILLGEDYEAKISDFGTAKLLKPDSSNWSAVAGTYGYVAPELAYAMKVTEKCDVYSFGVLTLEVIKGEHPGDLVSTLSSSPPDATLSLKSISDHRLPEPTPEIKEEVLEILKVALLCLHSDPQARPTMLSISTAFS DIP protein Q8VZG8 original sequence version: 103 7C9E44DE99DAE8BF mdis1_arath Protein MALE DISCOVERER 1 MDIS1 Probable LRR receptor-like serine/threonine-protein kinase At5g45840 K15I22.4 At5g45840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGCRWNPIGFQFSCFMFLIITLQSRSSLSLESEGFVLLKFRARVDSDPHGTLANWNVSDHDHFCSWFGVTCVDNKVQMLNLSGCSLGGTLAPELSQLSELRSLILSKNKLSGDIPNEFASFAKLEFLDLRDNNLNGVVPPELNKVLTPENLLLSGNKFAGFMTVKFLRLQSLYKVQMNKNRELSSVSADVLDCVNRKLGYCVSRRSLITRNKAKAFVLRIRATSRHYMVRRESHGKNYVVNYHPSENETSIFKRRELLEETSNLAAMPAPDTPSPSPEIITIVFPRSSGSFPALTNAKKRIPPLIPPSSPPPLPTNNTIASDPPRKFEEKSKGFKDVWLYVVIGVAAFVAMLIIVAVIFFFRKRAVKSIGPWKTGLSGQLQKAFVTGVPKLNRSELETACEDFSNIIEAFDGYTVYKGTLSSGVEIAVASTAILETREWTRAMEMTYRRRIDTMSRVNHKNFINLIGYCEEDEPFNRMMVFEYAPNGTLFEHLHDKEMEHLDWNARTRIIMGTAYCLQYMHELNPPISHTKLVSSAIYLTDDYAAKVGEVPFSGQTGSKPRKPMSGDLDQSLLPLPPEPETNVYSFGVLMLEIISGKLSDSEEEGSILKWASKYLENDNLRDMIDPTLTTYKEEELEAICDVARHCLKLDESQRPKMKYVVQQLKEVINISQEQATPRLSPLWWAELEILSSEAT DIP protein C0LGU7 original sequence version: 59 tdr_arath Leucine-rich repeat receptor-like protein kinase TDR TDR PXY Protein PHLOEM INTERCALATED WITH XYLEM Tracheary element differentiation inhibitory factor receptor MCI2.4 At5g61480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKKKNISPSLVLHPLLLLLLPFFAFNSLALKFSPQLLSLLSLKTSLSGPPSAFQDWKVPVNGQNDAVWCSWSGVVCDNVTAQVISLDLSHRNLSGRIPIQIRYLSSLLYLNLSGNSLEGSFPTSIFDLTKLTTLDISRNSFDSSFPPGISKLKFLKVFNAFSNNFEGLLPSDVSRLRFLEELNFGGSYFEGEIPAAYGGLQRLKFIHLAGNVLGGKLPPRLGLLTELQHMEIGYNHFNGNIPSEFALLSNLKYFDVSNCSLSGSLPQELGNLSNLETLFLFQNGFTGEIPESYSNLKSLKLLDFSSNQLSGSIPSGFSTLKNLTWLSLISNNLSGEVPEGIGELPELTTLFLWNNNFTGVLPHKLGSNGKLETMDVSNNSFTGTIPSSLCHGNKLYKLILFSNMFEGELPKSLTRCESLWRFRSQNNRLNGTIPIGFGSLRNLTFVDLSNNRFTDQIPADFATAPVLQYLNLSTNFFHRKLPENIWKAPNLQIFSASFSNLIGEIPNYVGCKSFYRIELQGNSLNGTIPWDIGHCEKLLCLNLSQNHLNGIIPWEISTLPSIADVDLSHNLLTGTIPSDFGSSKTITTFNVSYNQLIGPIPSGSFAHLNPSFFSSNEGLCGDLVGKPCNSDRFNAGNADIDGHHKEERPKKTAGAIVWILAAAIGVGFFVLVAATRCFQKSYGNRVDGGGRNGGDIGPWKLTAFQRLNFTADDVVECLSKTDNILGMGSTGTVYKAEMPNGEIIAVKKLWGKNKENGKIRRRKSGVLAEVDVLGNVRHRNIVRLLGCCTNRDCTMLLYEYMPNGSLDDLLHGGDKTMTAAAEWTALYQIAIGVAQGICYLHHDCDPVIVHRDLKPSNILLDADFEARVADFGVAKLIQTDESMSVVAGSYGYIAPEYAYTLQVDKKSDIYSYGVILLEIITGKRSVEPEFGEGNSIVDWVRSKLKTKEDVEEVLDKSMGRSCSLIREEMKQMLRIALLCTSRSPTDRPPMRDVLLILQEAKPKRKTVGDNVIVVGDVNDVNFEDVCSVDVGHDVKCQRIGV DIP protein Q9FII5 original sequence version: 55 DIP protein Q9FII5 original sequence version: 116 DIP protein Q9FII5 original sequence version: 97 mdis1-lure1.2-1 13 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 30 unspecified role unspecified role bait bait Region 30-340 Region 30-340 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mik1-lure1.2-1 3 27 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mdis1-lure1.2-2 10 28 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 29 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 27 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 30 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress association association mik1-mdis1-1 6 27 unspecified role unspecified role bait bait Region 699-983 Region 699-983 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 30 unspecified role unspecified role prey prey Region 363-668 Region 363-668 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mik1-lure1.2-2 26 27 unspecified role unspecified role bait bait Region 24-633 Region 24-633 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mik2-lure1.2-1 4 29 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mdis1-mik2-1 24 29 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 30 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mdis1-mik2-2 23 29 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco 30 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association mik2-lure1.2-2 8 29 unspecified role unspecified role bait bait Region 44-709 Region 44-709 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mdis1-lure1.2-3 9 28 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 30 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mik1-mik1-1 11 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 27 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mik1-lure1.2-3 20 27 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 28 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association lure1.2-mdis1-1 7 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 30 unspecified role unspecified role unspecified role unspecified role Region 30-340 Region 30-340 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mdis1-mdis1-1 15 30 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 30 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association lure1.2-mik1-1 2 27 unspecified role unspecified role unspecified role unspecified role Region 24-633 Region 24-633 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mdis1-mik1-1 14 27 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mik2-lure1.2-3 16 29 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 28 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association lure1.2-mik2-1 25 29 unspecified role unspecified role unspecified role unspecified role Region 44-709 Region 44-709 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mik1-mdis1-2 18 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 30 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mdis1-mik1-2 17 27 unspecified role unspecified role prey prey Region 24-633 Region 24-633 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 30 unspecified role unspecified role bait bait Region 30-340 Region 30-340 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mdis1-mik1-3 19 27 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco 30 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range tobac Nicotiana tabacum (Common tobacco) Common tobacco physical association physical association lure1.2-tdr-1 5 31 unspecified role unspecified role unspecified role unspecified role Region 30-652 Region 30-652 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mdis1-mik2-3 12 29 unspecified role unspecified role prey prey Region 44-709 Region 44-709 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 30 unspecified role unspecified role bait bait Region 30-340 Region 30-340 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mdis1-lure1.2-4 1 28 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 30 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mdis1-mik1-4 21 27 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 30 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association mdis1-mik2-4 22 29 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association