DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. Nature structural & molecular biology 2016 imex curation So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268844X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. Nature structural & molecular biology 2016 imex curation So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268843X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. Nature structural & molecular biology 2016 imex curation So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268846X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. Nature structural & molecular biology 2016 imex curation So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268842X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. Nature structural & molecular biology 2016 imex curation So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268845X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. Nature structural & molecular biology 2016 imex curation So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography So BR., Wan L., Zhang Z., Li P., Babiash E., Duan J., Younis I., Dreyfuss G. DIP original experiment: DIP-268847X Nature structural & molecular biology 2016 IMEx A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange. smd2_human Small nuclear ribonucleoprotein Sm D2 SNRPD2 snRNP core protein D2 SNRPD1 protein protein human Homo sapiens Human MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK DIP protein P62316 original sequence version: 74 DIP protein P62316 original sequence version: 97 DIP protein P62316 original sequence version: 83 DIP protein P62316 original sequence version: 134 D986059D82B7E045 ruxg_human Small nuclear ribonucleoprotein G SNRPG PBSCG Sm protein G protein protein human Homo sapiens Human MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV DIP protein P62308 original sequence version: 69 DIP protein P62308 original sequence version: 92 DIP protein P62308 original sequence version: 78 DIP protein P62308 original sequence version: 126 623302BF6BE758FE smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR DIP protein P62314 original sequence version: 77 DIP protein P62314 original sequence version: 100 DIP protein P62314 original sequence version: 86 DIP protein P62314 original sequence version: 135 0C81C94BF98E0810 gemi2_human Gem-associated protein 2 GEMIN2 SIP1 Component of gems 2 Survival of motor neuron protein-interacting protein 1 protein protein human Homo sapiens Human MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS DIP protein O14893 original sequence version: 146 DIP protein O14893 original sequence version: 114 3232F410EA98EB81 ruxf_human Small nuclear ribonucleoprotein F SNRPF PBSCF Sm protein F protein protein human Homo sapiens Human MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE DIP protein P62306 original sequence version: 64 DIP protein P62306 original sequence version: 84 DIP protein P62306 original sequence version: 73 DIP protein P62306 original sequence version: 120 416B88D575DAE58A ru17_human U1 small nuclear ribonucleoprotein 70 kDa SNRNP70 RPU1 U1AP1 RNPU1Z SNRP70 protein protein human Homo sapiens Human MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE DIP protein P08621 original sequence version: 92 DIP protein P08621 original sequence version: 152 DIP protein P08621-1 original sequence version: 191 F1020BF5C40CF97D smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B smd3_human Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein human Homo sapiens Human MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR DIP protein P62318 original sequence version: 72 DIP protein P62318 original sequence version: 95 DIP protein P62318 original sequence version: 81 DIP protein P62318 original sequence version: 102 DIP protein P62318 original sequence version: 131 59A6E78E860AA3E0 rsmb_human Small nuclear ribonucleoprotein-associated proteins B and B' Sm protein B/B' SNRPB COD SNRPB1 protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP DIP protein P14678 original sequence version: 150 DIP protein P14678 original sequence version: 131 DIP protein P14678 original sequence version: 186 F2E1D5E11A601170 ruxe_human Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein human Homo sapiens Human MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN DIP protein P62304 original sequence version: 64 DIP protein P62304 original sequence version: 87 DIP protein P62304 original sequence version: 73 DIP protein P62304 original sequence version: 123 7D8881CE1F4FA2FD snrnp70-smn1-1 5 13 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role bait bait Region 90-194 Region 90-194 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction snrnp70-gemin2-1 4 8 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role prey prey ecolx Escherichia coli 10 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role bait bait Region 1-99 Region 1-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association snrnp70-gemin2-2 2 10 unspecified role unspecified role prey prey ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role bait bait Region 1-99 Region 1-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association snrnp70-smn1-2 6 13 unspecified role unspecified role prey prey Region 189-294 Region 189-294 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 12 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 90-194 Region 90-194 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Deletion of region 1-91 decreased the interaction rate/strength. Deletion of region 279-294 decreased the interaction rate/strength. snrnp70-smn1-3 3 13 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-194 Region 1-194 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snrnp70-snrpb-3 1 14 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role prey prey ecolx Escherichia coli 12 unspecified role unspecified role bait bait Region 1-99 Region 1-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association