DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268827X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions in vitro In vitro thermal shift thermal shift binding thermal shift predetermined predetermined participant predetermined Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268831X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268830X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268832X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268828X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268823X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268829X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268824X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268826X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Structural basis and function of XRN2 binding by XTB domains. Nature structural & molecular biology 2016 imex curation Richter H., Katic I., Gut H., Großhans H. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Richter H., Katic I., Gut H., Großhans H. DIP original experiment: DIP-268825X Nature structural & molecular biology 2016 IMEx Structural basis and function of XRN2 binding by XTB domains. q5xjm4_danre cdkn2aipnl zgc:101768 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MASMDVEEFIGQNRQLADRVEAFRGFSESDKHWKGRREFIFRNMADFPEPQVDHLLALSMVWQNHVFMGCRYSSELLQRVMEMAEGIEVEDAPVFKTRDEIIRQQKQR DIP protein Q5XJM4 original sequence version: 73 f1qzx8_danre cdkn2aip protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAARRGEDIVSEFLSQNPHLVSWVESLRGHCETNKQWYARREFVLRNMEAFPTIQPGSPSSSLDRLLSLSMVWANHVFLGCRYPQRVMDKINEMAEGITVIEAPERKTRDEIMGKLKRPAVSAADADYQGKKTKPNEPDDRAHSKCVVHPATSSHKCGPSPGAPAEHQPFFNRLYKAVAWKLVSAGGFGPNLEHFEILRSCVESCKASLTCVFVPLKDIPDLPAGRTQREGQVCELRCCTVYMGTGYGRDESAARAMASKEALKVFQGQKVTVKISRRRFRGRDVDDLVLLDEQSRSQAFPPALSCPFQEDE DIP protein F1QZX8 original sequence version: 29 xrn2_human 5'-3' exoribonuclease 2 XRN2 DHM1-like protein protein protein human Homo sapiens Human MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPAPKNEDEMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGEFIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHLPSLEIRENAIDRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKEKRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN DIP protein Q9H0D6 original sequence version: 130 DIP protein Q9H0D6 original sequence version: 141 DIP protein Q9H0D6 original sequence version: 140 763B5E0E628F97A8 c2ail_human CDKN2AIP N-terminal-like protein CDKN2AIPNL CDKN2A-interacting protein N-terminal-like protein protein protein human Homo sapiens Human MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS DIP protein Q96HQ2 original sequence version: 89 26166C4274FE679C xrn2_caeel 5'-3' exoribonuclease 2 homolog Y48B6A.3 xrn-2 protein protein caeel Caenorhabditis elegans MGVPAFFRWLTKKYPATVVNANEDRQRDQDGNRVPVDCTQPNPNFQEFDNLYLDMNGIIHPCTHPEDRPAPKNEDEMFALIFEYIDRIYSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEMAEKEASIEEQRNRLMAEGIAVPPKKKEEAHFDSNCITPGTPFMARLADALRYYIHDRVTNDASWANIEIILSDANVPGEGEHKIMDYVRKQRGNPAHDPNTVHCLCGADADLIMLGIATHEANFNIIREEFVPNQPRACDLCGQYGHELKECRGAENETDLGDDYCKPEQREKNFIFLRIPVLREYLEKELSMPNLPFKFDVERALDDWVFLCFFVGNDFLPHLPSLEIREGAIDRLIKLYKEMVYQMKGYLTKDGIPELDRVEMIMKGLGRVEDEIFKRRQQDEERFQENQRNKKARMQMYGGGGRGGRGRGRGRGQQPAFVPTHGILAPMAAPMHHSGESTRQMASEARQTAMKFTNDANETAAANLKALLNVKGEESPADIASRKRKAEQPLIKPEEEEDEGPKDDIRLYESGWKDRYYRAKFDVGSDDIEFRHRVAWAYVEGLCWVLRYYYQGCASWDWYFPYHYAPFASDFETVGEFQPDFTRPTKPFNPLEQLMSVFPAASKQHLPVEWQKLMIQDDSPIIDLYPADFRIDLNGKKYAWQGVALLPFVDETRLLATLQSVYPTLTAEEKQRNTRGPNRIFIGRNHKSFEFFQQVAESKSDDLVPLDPTLLNGVSGKIAYDSTATAPGLPFVSPVNHDECQDLPTNCGICVLYEDPEYPQDYIFPALRLDGAKEPEKTLKPDDWNDRRDGRYQPQVGFNRNAPRGSLDQSGHRQVHHYVRGGGGGGGGYRGNSYDDRRGGGGGGGGYNDRQDFGRNYGGRDGGGPQRYHDQQQQRQGGYQGGGYGGGYGGGGGGGGGGGGGSYHQPYNQDQRRGGRGGGGGPPGYQRPPYRGGGGGGYHGNSSWR DIP protein Q9U299 original sequence version: 109 219234BA731ABCF6 a0a0r4isj3_danre 5'-3' exoribonuclease xrn2 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MGVPAFFRWLSRKYPSIIVHCLEEKAKEYNGVKIPVDTSKPNPNEVEFDNLYLDMNGIIHPCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQQRSRRFRASKEGVELAEEKQKMREEVIERGGYLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYVADRLTNDPGWRNITVFLSDASVPGEGEHKIMDYIRRQRGQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPRPCALCSQMGHEIKDCQGLPREKQGEHDEFADTIPVSEQEFIFIRLAVLREYLERELTMASLPFPFSFERSVDDWVFMCFFVGNDFLPHLPSLEIREGAIDRLVGIYKDVVHKTGGYLTENGFVNLERVELIMQAVGVAEDNIFKKRKEDDESFKRRMKDKKKRMKAEQRPSFLPGGQFAPHALGGRDRPMAVQNARHAAFEMRMQGNQRNQDAAQSLRAMMRNGKGSAESSGSMDNRGVKRKADDSDSEPEPEDNVRLWEDGWKQRYYKTKFDVDATDDEFRKKVVQSYVEGLCWVLRYYYQGCASWKWYFPFHYAPFASDFKDIKGMFSDFEKGTKPFKPLEQLMGVFPAASGNFLPTTWRALMSDPESSIIDFYPDDFAIDLNGKKYAWQGVALLPFVDERRLRAALAEVYNDLTPEEVRRNSLGSDVMFVGRSHALCDFIQELYRAESHTATEIPAEFCHGIQGILNLDEDPILPDKLVESPIPVLRDISSNCAIGIKFKDPQYADGFVFKAVILPGAKIPNKVLKPGDWEQSNRGPWRPQLGFNPNRQQAHLDQSAFRKLNHHVGRSDGPGIYGSGPPSDAHRRGGAYSSAPPPTNYHQGNYRPPQRDHYSQSQSQYSRQPHMNTGSYPRFQQGSHGWDRAMQNQGSSYQQNQQRGRGDWRPQQNQQGFNSGRGYGLPPASRRYNWN DIP protein A0A0R4ISJ3 original sequence version: 2 paxt1_caeel Partner of xrn-2 protein 1 paxt-1 R05D11.6 protein protein caeel Caenorhabditis elegans MGKLEDVEAEKKLWESDDAWELRKAFMLAHYDDYPKIQLQCLSQLFINVTLLGCEYSQTLMQKIRTMGAGIAANKDRTKTGSYVKASAAKKRQAVKTSDLEGASDESKKVKMEKSPSPVARESFDERLGKLKASLAMTPHHLTGEQMMKTATNSCLMKWHVNKINQKIEITIDRYVAFRHTFSQYCVDPRDCAINTLIESILSCDAAVHEESYEIRFDGVPVDECYAKSVTRRLAKIKSAVSNGAHTVKGLTTYLDAVNMSMIQNTQKLEGWSQQLDLVTADLLLSSRVLSSTECTKPAMATIANQMSEDVCQLILNDKINVINSMKSHSSLAFQ DIP protein Q21738 original sequence version: 87 96C7EDA67AA4CA02 cdkn2aipnl-xrn2-1 10 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 1-803 Region 1-803 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cdkn2aipnl-xrn2-2 6 16 unspecified role unspecified role prey prey Region 1-803 Region 1-803 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association cdkn2aipnl-xrn2-3 7 13 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait Q96HQ2:p.Tyr81Ala Y81A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y81A'. Wed May 02 20:01:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr81ala' Tue Jun 30 18:14:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr81Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Tag used for western blot detection. human Homo sapiens Human physical association physical association paxt_1-xrn_2-1 1 15 unspecified role unspecified role unspecified role unspecified role Region 1-257/295-417/532-787 Region 1-257/295-417/532-787 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 1-75 Region 1-75 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction paxt_1-xrn_2-2 2 15 unspecified role unspecified role unspecified role unspecified role Region 1-257/295-417/532-787 Region 1-257/295-417/532-787 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 1-75 Region 1-75 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cdkn2aip-xrn2-1 8 12 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey Region 1-803 Region 1-803 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association paxt_1-xrn_2-3 9 15 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait Q21738:p.Cys54Ala C54A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C54A'. Wed May 02 15:33:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys54ala' Tue Jun 30 19:34:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys54Ala' Q21738:p.Tyr56Ala Y56A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y56A'. Wed May 02 18:39:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr56ala' Tue Jun 30 16:55:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr56Ala' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association cdkn2aipnl-xrn_2-1 3 15 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range caeel Caenorhabditis elegans physical association physical association paxt_1-xrn_2-4 5 15 unspecified role unspecified role unspecified role unspecified role Region 1-257/295-417/532-787 Region 1-257/295-417/532-787 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 1-75 Region 1-75 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction paxt_1-xrn_2-5 4 15 unspecified role unspecified role unspecified role unspecified role Region 1-257/295-417/532-787 Region 1-257/295-417/532-787 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role Region 1-75 Region 1-75 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction