IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Allele-specific recognition by LILRB3 and LILRA6 of a cytokeratin 8-associated ligand on necrotic glandular epithelial cells. Allele-specific recognition by LILRB3 and LILRA6 of a cytokeratin 8-associated ligand on necrotic glandular epithelial cells. Oncotarget 2016 imex curation Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J. The sequence of the LILRB3*12 allele has been taken from Reference 12-PMID: 24257760, Genbank accession number KF294242 (Trembl entry U5QBD0). However the authors have not verified this is the correct sequence. jt233@cam.ac.uk 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J. The sequence of the LILRB3*12 allele has been taken from Reference 12-PMID: 24257760, Genbank accession number KF294242 (Trembl entry U5QBD0). However the authors have not verified this is the correct sequence. jt233@cam.ac.uk Accepted 2017-SEP-12 AT 08:18 BST AT 08:18 BST by ORCHARD Oncotarget 2016 imex curation you might want to delete this publication in the light of my updated Data-Proc comment here and also I had assumed the LILRB3 *01 allele would correspond to the UniProt entry O75022 - but it does not. I will ask UniProt to Update the entry for LILRB3, but what their response might be I am not sure.. I have added Swiss-P identifier and mutations + Daudi cell interaction. + ecd - corresponding to length of molecule in NCBI; LILRB3 Protein altered as before, Roles altered. Allele-specific recognition by LILRB3 and LILRA6 of a cytokeratin 8-associated ligand on necrotic glandular epithelial cells. Allele-specific recognition by LILRB3 and LILRA6 of a cytokeratin 8-associated ligand on necrotic glandular epithelial cells. Oncotarget 2016 imex curation Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J. The sequence of the LILRB3*12 allele has been taken from Reference 12-PMID: 24257760, Genbank accession number KF294242 (Trembl entry U5QBD0). However the authors have not verified this is the correct sequence. jt233@cam.ac.uk 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom sequence tag sequence tag identification sequence tag Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J., Jones DC., Hewitt CR., López-Álvarez MR., Jahnke M., Russell AI., Radjabova V., Trowsdale AR., Trowsdale J. Genbank accession number KF294242 is the only possible accession no for this LILRB3*12 variant (I have checked them all for the "GYR" sequence and this is the only one). There are 15 "mutations" between the sequence given in Table 1 Ref 12 and O75022. If you do not like the use of Trembl entry U5QBD0 I could re-map to O75022 (extracellular region aas 24-443). ** no there are 21 differences!** Should I ask UniProt to update O75022 taking into account Ref12 -lots of extra alleles given? DSP+84? The sequence of the LILRB3*12 allele has been taken from Reference 12-PMID: 24257760, Genbank accession number KF294242 (Trembl entry U5QBD0). However the authors have not verified this is the correct sequence. jt233@cam.ac.uk Accepted 2017-SEP-12 AT 08:18 BST AT 08:18 BST by ORCHARD Oncotarget 2016 imex curation you might want to delete this publication in the light of my updated Data-Proc comment here and also I had assumed the LILRB3 *01 allele would correspond to the UniProt entry O75022 - but it does not. I will ask UniProt to Update the entry for LILRB3, but what their response might be I am not sure.. I have added Swiss-P identifier and mutations + Daudi cell interaction. + ecd - corresponding to length of molecule in NCBI; LILRB3 Protein altered as before, Roles altered. k2c8_human Keratin, type II cytoskeletal 8 Keratin-8 KRT8 CYK8 Cytokeratin-8 Type-II keratin Kb8 protein protein human Homo sapiens Human MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK DIP protein P05787 original sequence version: 186 DIP protein P05787 original sequence version: 146 B0BC730B65929D37 fpps_human Farnesyl pyrophosphate synthase Farnesyl diphosphate synthase FDPS FPS KIAA1293 (2E,6E)-farnesyl diphosphate synthase Dimethylallyltranstransferase Geranyltranstransferase protein protein human Homo sapiens Human MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK 52934B80A808FB67 actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 lirb3_human Leukocyte immunoglobulin-like receptor subfamily B member 3 LILRB3 ILT5 LIR3 CD85 antigen-like family member A Immunoglobulin-like transcript 5 Monocyte inhibitory receptor HL9 protein protein human Homo sapiens Human MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH 595B1BD5283A7E3E k1c18_human Keratin, type I cytoskeletal 18 KRT18 CYK18 Keratin-18 PIG46 Cytokeratin-18 Cell proliferation-inducing gene 46 protein protein protein human Homo sapiens Human MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH DIP protein P05783 original sequence version: 186 DIP protein P05783 original sequence version: 175 1E5604C6BCC7A17A k1c19_human Keratin, type I cytoskeletal 19 Cytokeratin-19 Keratin-19 KRT19 protein protein human Homo sapiens Human MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGAYGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL DIP protein P08727 original sequence version: 118 DIP protein P08727 original sequence version: 161 C559BBBACCE32DCB 47ery-1 2 5 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 8 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 7 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 3 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 6 unspecified role unspecified role bait bait extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range gln53leu variant variant certain certain sequence position certain certain certain sequence position certain Q L his61asp variant variant certain certain sequence position certain certain certain sequence position certain H D leu69trp variant variant certain certain sequence position certain certain certain sequence position certain L W region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glu90gln variant variant certain certain sequence position certain certain certain sequence position certain E Q met115leu variant variant certain certain sequence position certain certain certain sequence position certain M L ala120phe variant variant certain certain sequence position certain certain certain sequence position certain A F ser122asn variant variant certain certain sequence position certain certain certain sequence position certain S N arg175gly variant variant certain certain sequence position certain certain certain sequence position certain R G asn252asp variant variant certain certain sequence position certain certain certain sequence position certain N D pro288arg variant variant certain certain sequence position certain certain certain sequence position certain P R asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain N Y asn314asp variant variant certain certain sequence position certain certain certain sequence position certain N D mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain M I trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain WWQ RGY tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain Y R his409phe variant variant certain certain sequence position certain certain certain sequence position certain H F val417met variant variant certain certain sequence position certain certain certain sequence position certain V M human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells association association 6B allele LILRB3*12 lilrb3-actb-2 2 5 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma 8 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma 7 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma 3 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma 6 unspecified role unspecified role bait bait extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range gln53leu variant variant certain certain sequence position certain certain certain sequence position certain Q L his61asp variant variant certain certain sequence position certain certain certain sequence position certain H D leu69trp variant variant certain certain sequence position certain certain certain sequence position certain L W region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glu90gln variant variant certain certain sequence position certain certain certain sequence position certain E Q met115leu variant variant certain certain sequence position certain certain certain sequence position certain M L ala120phe variant variant certain certain sequence position certain certain certain sequence position certain A F ser122asn variant variant certain certain sequence position certain certain certain sequence position certain S N arg175gly variant variant certain certain sequence position certain certain certain sequence position certain R G asn252asp variant variant certain certain sequence position certain certain certain sequence position certain N D pro288arg variant variant certain certain sequence position certain certain certain sequence position certain P R asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain N Y asn314asp variant variant certain certain sequence position certain certain certain sequence position certain N D mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain M I trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain WWQ RGY tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain Y R his409phe variant variant certain certain sequence position certain certain certain sequence position certain H F val417met variant variant certain certain sequence position certain certain certain sequence position certain V M human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role prey prey human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma association association 6Bi allele LILRB3*12 lilrb3-actb-3 1 3 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range gln53leu variant variant certain certain sequence position certain certain certain sequence position certain Q L his61asp variant variant certain certain sequence position certain certain certain sequence position certain H D leu69trp variant variant certain certain sequence position certain certain certain sequence position certain L W region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glu90gln variant variant certain certain sequence position certain certain certain sequence position certain E Q met115leu variant variant certain certain sequence position certain certain certain sequence position certain M L ala120phe variant variant certain certain sequence position certain certain certain sequence position certain A F ser122asn variant variant certain certain sequence position certain certain certain sequence position certain S N arg175gly variant variant certain certain sequence position certain certain certain sequence position certain R G asn252asp variant variant certain certain sequence position certain certain certain sequence position certain N D pro288arg variant variant certain certain sequence position certain certain certain sequence position certain P R asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain N Y asn314asp variant variant certain certain sequence position certain certain certain sequence position certain N D mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain M I trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain WWQ RGY tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain Y R his409phe variant variant certain certain sequence position certain certain certain sequence position certain H F val417met variant variant certain certain sequence position certain certain certain sequence position certain V M association association 7A allele LILRB3*12 krt8-lilrb3-1 1 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component extracellular_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range gln53leu variant variant certain certain sequence position certain certain certain sequence position certain Q L his61asp variant variant certain certain sequence position certain certain certain sequence position certain H D leu69trp variant variant certain certain sequence position certain certain certain sequence position certain L W region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined glu90gln variant variant certain certain sequence position certain certain certain sequence position certain E Q met115leu variant variant certain certain sequence position certain certain certain sequence position certain M L ala120phe variant variant certain certain sequence position certain certain certain sequence position certain A F ser122asn variant variant certain certain sequence position certain certain certain sequence position certain S N arg175gly variant variant certain certain sequence position certain certain certain sequence position certain R G asn252asp variant variant certain certain sequence position certain certain certain sequence position certain N D pro288arg variant variant certain certain sequence position certain certain certain sequence position certain P R asn290tyr variant variant certain certain sequence position certain certain certain sequence position certain N Y asn314asp variant variant certain certain sequence position certain certain certain sequence position certain N D mrt317ile variant variant certain certain sequence position certain certain certain sequence position certain M I trp_trp_gln348-350arg_gly_tyr variant variant certain certain sequence position certain certain certain sequence position certain WWQ RGY tyr400arg variant variant certain certain sequence position certain certain certain sequence position certain Y R his409phe variant variant certain certain sequence position certain certain certain sequence position certain H F val417met variant variant certain certain sequence position certain certain certain sequence position certain V M association association 7Ai allele LILRB3*12 Binding of CK18 was much reduced in cytokeratin 8 knock-down cells.