DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268628X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268620X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268613X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268615X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268629X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268616X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268624X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268621X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268623X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268618X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268627X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268617X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268630X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268625X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268614X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268622X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268619X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268612X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268631X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. Nature 2016 imex curation Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao DY., Gish G., Braunschweig U., Li Y., Ni Z., Schmitges FW., Zhong G., Liu K., Li W., Moffat J., Vedadi M., Min J., Pawson TJ., Blencowe BJ., Greenblatt JF. DIP original experiment: DIP-268626X Nature 2016 IMEx SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. tdrd3_human Tudor domain-containing protein 3 TDRD3 protein protein human Homo sapiens Human MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLTSNKQKPVMGPPLRGRGKGRGRIRSEDEEDLGNARPSAPSTLFDFLESKMGTLNVEEPKSQPQQLHQGQYRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPPRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGPSFAEAKENPLPQGSVDYNNQKRGKRESQTSIPDYFYDRKSQTINNEAFSGIKIEKHFNVNTDYQNPVRSNSFIGVPNGEVEMPLKGRRIGPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKPEKILESSIPMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPIQTEAWEEEGTYDQTLEFRRGGDGQPRRSTRPTQQFYQPPRARN DIP protein Q9H7E2 original sequence version: 119 1D82F323F6EF4B05 xrn2_human 5'-3' exoribonuclease 2 XRN2 DHM1-like protein protein protein human Homo sapiens Human MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPAPKNEDEMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEILAKGGFLPPEEIKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGEFIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHLPSLEIRENAIDRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKEKRKRMKRDQPAFTPSGILTPHALGSRNSPGSQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN DIP protein Q9H0D6 original sequence version: 130 DIP protein Q9H0D6 original sequence version: 141 DIP protein Q9H0D6 original sequence version: 140 763B5E0E628F97A8 setx_human Probable helicase senataxin SETX ALS4 KIAA0625 SCAR1 SEN1 homolog Amyotrophic lateral sclerosis 4 protein Senataxin protein protein human Homo sapiens Human MSTCCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEVLWELETLRLINHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFENKLRVPLLEILKYPYLLLHERVNELCVEALCRMEQANCSFQVFDKHPGIYLFLVHPNEMVRRWAILTARNLGKVDRDDYYDLQEVLLCLFKVIELGLLESPDIYTSSVLEKGKLILLPSHMYDTTNYKSYWLGICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEREADDDSVDPFWPALHCFMVILDRLGSKVWGQLMDPIVAFQTIINNASYNREIRHIRNSSVRTKLEPESYLDDMVTCSQIVYNYNPEKTKKDSGWRTAICPDYCPNMYEEMETLASVLQSDIGQDMRVHNSTFLWFIPFVQSLMDLKDLGVAYIAQVVNHLYSEVKEVLNQTDAVCDKVTEFFLLILVSVIELHRNKKCLHLLWVSSQQWVEAVVKCAKLPTTAFTRSSEKSSGNCSKGTAMISSLSLHSMPSNSVQLAYVQLIRSLLKEGYQLGQQSLCKRFWDKLNLFLRGNLSLGWQLTSQETHELQSCLKQIIRNIKFKAPPCNTFVDLTSACKISPASYNKEESEQMGKTSRKDMHCLEASSPTFSKEPMKVQDSVLIKADNTIEGDNNEQNYIKDVKLEDHLLAGSCLKQSSKNIFTERAEDQIKISTRKQKSVKEISSYTPKDCTSRNGPERGCDRGIIVSTRLLTDSSTDALEKVSTSNEDFSLKDDALAKTSKRKTKVQKDEICAKLSHVIKKQHRKSTLVDNTINLDENLTVSNIESFYSRKDTGVQKGDGFIHNLSLDPSGVLDDKNGEQKSQNNVLPKEKQLKNEELVIFSFHENNCKIQEFHVDGKELIPFTEMTNASEKKSSPFKDLMTVPESRDEEMSNSTSVIYSNLTREQAPDISPKSDTLTDSQIDRDLHKLSLLAQASVITFPSDSPQNSSQLQRKVKEDKRCFTANQNNVGDTSRGQVIIISDSDDDDDERILSLEKLTKQDKICLEREHPEQHVSTVNSKEEKNPVKEEKTETLFQFEESDSQCFEFESSSEVFSVWQDHPDDNNSVQDGEKKCLAPIANTTNGQGCTDYVSEVVKKGAEGIEEHTRPRSISVEEFCEIEVKKPKRKRSEKPMAEDPVRPSSSVRNEGQSDTNKRDLVGNDFKSIDRRTSTPNSRIQRATTVSQKKSSKLCTCTEPIRKVPVSKTPKKTHSDAKKGQNRSSNYLSCRTTPAIVPPKKFRQCPEPTSTAEKLGLKKGPRKAYELSQRSLDYVAQLRDHGKTVGVVDTRKKTKLISPQNLSVRNNKKLLTSQELQMQRQIRPKSQKNRRRLSDCESTDVKRAGSHTAQNSDIFVPESDRSDYNCTGGTEVLANSNRKQLIKCMPSEPETIKAKHGSPATDDACPLNQCDSVVLNGTVPTNEVIVSTSEDPLGGGDPTARHIEMAALKEGEPDSSSDAEEDNLFLTQNDPEDMDLCSQMENDNYKLIELIHGKDTVEVEEDSVSRPQLESLSGTKCKYKDCLETTKNQGEYCPKHSEVKAADEDVFRKPGLPPPASKPLRPTTKIFSSKSTSRIAGLSKSLETSSALSPSLKNKSKGIQSILKVPQPVPLIAQKPVGEMKNSCNVLHPQSPNNSNRQGCKVPFGESKYFPSSSPVNILLSSQSVSDTFVKEVLKWKYEMFLNFGQCGPPASLCQSISRPVPVRFHNYGDYFNVFFPLMVLNTFETVAQEWLNSPNRENFYQLQVRKFPADYIKYWEFAVYLEECELAKQLYPKENDLVFLAPERINEEKKDTERNDIQDLHEYHSGYVHKFRRTSVMRNGKTECYLSIQTQENFPANLNELVNCIVISSLVTTQRKLKAMSLLGSRNQLARAVLNPNPMDFCTKDLLTTTSERIIAYLRDFNEDQKKAIETAYAMVKHSPSVAKICLIHGPPGTGKSKTIVGLLYRLLTENQRKGHSDENSNAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKDKKNPLGNCGDINLVRLGPEKSINSEVLKFSLDSQVNHRMKKELPSHVQAMHKRKEFLDYQLDELSRQRALCRGGREIQRQELDENISKVSKERQELASKIKEVQGRPQKTQSIIILESHIICCTLSTSGGLLLESAFRGQGGVPFSCVIVDEAGQSCEIETLTPLIHRCNKLILVGDPKQLPPTVISMKAQEYGYDQSMMARFCRLLEENVEHNMISRLPILQLTVQYRMHPDICLFPSNYVYNRNLKTNRQTEAIRCSSDWPFQPYLVFDVGDGSERRDNDSYINVQEIKLVMEIIKLIKDKRKDVSFRNIGIITHYKAQKTMIQKDLDKEFDRKGPAEVDTVDAFQGRQKDCVIVTCVRANSIQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQDAQKRGAIIKTCDKNYRHDAVKILKLKPVLQRSLTHPPTIAPEGSRPQGGLPSSKLDSGFAKTSVAASLYHTPSDSKEITLTVTSKDPERPPVHDQLQDPRLLKRMGIEVKGGIFLWDPQPSSPQHPGATPPTGEPGFPVVHQDLSHIQQPAAVVAALSSHKPPVRGEPPAASPEASTCQSKCDDPEEELCHRREARAFSEGEQEKCGSETHHTRRNSRWDKRTLEQEDSSSKKRKLL DIP protein Q7Z333 original sequence version: 131 552FFE4A23A83868 smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B anm5_human Protein arginine N-methyltransferase 5 PRMT5 IBP72 JBP1 HRMT1L5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 72 kDa ICln-binding protein SKB1 Histone-arginine N-methyltransferase PRMT5 protein protein human Homo sapiens Human MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL DIP protein O14744 original sequence version: 86 DIP protein O14744 original sequence version: 104 DIP protein O14744-1 original sequence version: 148 DIP protein O14744-1 original sequence version: 114 DIP protein O14744 original sequence version: 146 522E255B384F25E7 rpb1_human DNA-directed RNA polymerase II subunit RPB1 POLR2A DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit POLR2 RNA-directed RNA polymerase II subunit RPB1 protein protein human Homo sapiens Human MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN DIP protein P24928 original sequence version: 108 DIP protein P24928 original sequence version: 147 DIP protein P24928 original sequence version: 158 DIP protein P24928 original sequence version: 157 DIP protein P24928 original sequence version: 179 DIP protein P24928 original sequence version: 181 DIP protein P24928 original sequence version: 161 DIP protein P24928 original sequence version: 175 DIP protein P24928-1 original sequence version: 175 DIP protein P24928 original sequence version: 68 DIP protein P24928 original sequence version: 116 28D6FD25693A6472 polr2a-prmt5-1 18 22 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human association association smn1-polr2a-1 7 24 unspecified role unspecified role bait bait human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association polr2a-smn1-1 6 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association polr2a-setx-1 17 26 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P24928:p.Arg1810Ala R1810A mutation mutation certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R1810A'. Wed May 02 18:34:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1810ala' Tue Jun 30 15:39:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1810Ala' human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association polr2a-smn1-2 5 26 unspecified role unspecified role unspecified role unspecified role Region 1804-1816 Region 1804-1816 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1810me2 R1810me2 nnme2arg dimethylated L-arginine Dimethyl NNMe2Arg dimethylr certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm FITC-label FITC-label fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 24 unspecified role unspecified role unspecified role unspecified role Region 80-170 Region 80-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-smn1-3 19 26 unspecified role unspecified role unspecified role unspecified role Region 1801-1815 Region 1801-1815 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1810me2 R1810me2 nnme2arg dimethylated L-arginine Dimethyl NNMe2Arg dimethylr certain certain sequence position certain certain certain sequence position certain in vitro In vitro 24 unspecified role unspecified role unspecified role unspecified role Region 80-170 Region 80-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction prmt5-polr2a-1 1 23 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human association association smn1-polr2a-2 3 22 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role bait bait human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human association association smn1-setx-1 2 23 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association polr2a-prmt5-2 14 23 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human association association polr2a-setx-2 12 26 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human association association polr2a-smn1-4 13 26 unspecified role unspecified role unspecified role unspecified role Region 1597-1610 Region 1597-1610 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain R1603me2 R1603me2 nnme2arg dimethylated L-arginine Dimethyl NNMe2Arg dimethylr certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm FITC-label FITC-label fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 24 unspecified role unspecified role unspecified role unspecified role Region 80-170 Region 80-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction polr2a-setx-3 16 23 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association polr2a-setx-4 20 23 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human association association setx-smn1-1 8 23 unspecified role unspecified role bait bait human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association polr2a-prmt5-3 15 25 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association tdrd3-polr2a-1 9 21 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association polr2a-smn1-5 10 26 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P24928:p.Arg1810Ala R1810A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R1810A'. Wed May 02 14:50:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1810ala' Tue Jun 30 15:54:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1810Ala' human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human association association polr2a-prmt5-4 11 23 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human association association polr2a-prmt5-5 4 25 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role bait bait human Homo sapiens Human association association