DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Structure (London, England : 1993) 2016 imex curation Lubman OY., Fremont DH. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268461X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Structure (London, England : 1993) 2016 imex curation Lubman OY., Fremont DH. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268456X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Structure (London, England : 1993) 2016 imex curation Lubman OY., Fremont DH. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268457X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Structure (London, England : 1993) 2016 imex curation Lubman OY., Fremont DH. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268458X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Structure (London, England : 1993) 2016 imex curation Lubman OY., Fremont DH. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268459X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. Structure (London, England : 1993) 2016 imex curation Lubman OY., Fremont DH. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lubman OY., Fremont DH. DIP original experiment: DIP-268460X Structure (London, England : 1993) 2016 IMEx Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors. ccl2_mouse C-C motif chemokine 2 Ccl2 Je Mcp1 Scya2 Monocyte chemoattractant protein 1 Monocyte chemotactic protein 1 Platelet-derived growth factor-inducible protein JE Small-inducible cytokine A2 protein protein mouse Mus musculus Mouse MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN DIP protein P10148 original sequence version: 143 e9m5r0_9gama RHVP-L.R17 RHVP.R17 protein protein cricetid gammaherpesvirus 2 Cricetid gammaherpesvirus 2 MANRSGMGGCMMLSLLIAGMSLMLGHCGPVGEPVASEINEASKVSSRLLTQDILFRKDRQATISLPIKLPVEDIITQTCDKITYGPLKFLDLLEKETAVLPLSTDITCPACLGRAVLVGKWECPAHVAVNESDLTVFGPNKEEHVPQFVTVQQPSDGKMQRLFFAKFLGTEESLAVLRVPGPDGHLCIQEALIHFKELSGAGVCSLWKANDSREEGLEMKQVDCLETTVLENQTCIATTLSKKIYHRLYCGERLMTGGQVSTRVLLTALGFYKRQPYTFHRVPKGMVYVHLIDSGSEDYMEYSECEEVTPGRYEDKQISYTFYTDLFQTADGEPVLASVWGTSGLKDSAYESCAFVIPTKGRRKLVPRRIMSKCYPFRLTYHPSTMTVRLDVRVEKHHGATDQGFVFLKMESGTYSEGREYYLDRVLWGEDSSTNNVLQ DIP protein E9M5R0 original sequence version: 7 ccl3_mouse C-C motif chemokine 3 Ccl3 Mip1a Scya3 Heparin-binding chemotaxis protein L2G25B Macrophage inflammatory protein 1-alpha SIS-alpha Small-inducible cytokine A3 TY-5 protein protein mouse Mus musculus Mouse MKVSTTALAVLLCTMTLCNQVFSAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA DIP protein P10855 original sequence version: 145 ccl3-e9m5r0_9gama-1 2 9 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction ccl3-e9m5r0_9gama-2 6 9 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction e9m5r0_9gama-ccl2-1 5 7 unspecified role unspecified role prey prey Region 24-148 Region 24-148 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P10148:p.Leu70Arg L70R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L70R'. Wed May 02 19:14:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu70arg' Tue Jun 30 19:04:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu70Arg' P10148:p.Lys71Asn K71N mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K N This feature has been corrected as a result of our quality control procedures. The original label was 'K71N'. Wed May 02 18:30:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys71asn' Tue Jun 30 19:22:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys71Asn' P10148:p.[Leu70Arg;Lys71Asn] L70R/K71N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K N certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L70R/K71N'. Wed May 02 18:35:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu70arg,lys71asn' Tue Jun 30 19:31:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu70Arg;Lys71Asn]' ecolx Escherichia coli 8 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction e9m5r0_9gama-ccl3-1 3 9 unspecified role unspecified role prey prey Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction ccl3-e9m5r0_9gama-3 1 9 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction e9m5r0_9gama-ccl2-2 4 7 unspecified role unspecified role prey prey Region 24-148 Region 24-148 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait E9M5R0:p.[Asp293_Ser294delinsAsnAla;Ser296_Glu297delinsAlaGln] D266N/S267A/S269A/E270Q mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain DS NA certain certain sequence position certain certain certain sequence position certain SE AQ Fri Jul 28 10:48:59 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_ser266-267asn_ala,ser_glu269-270ala_gln' Wed May 02 16:57:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_ser293-294asn_ala,ser_glu296-297ala_gln' Tue Jun 30 15:53:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp293_Ser294delinsAsnAla;Ser296_Glu297delinsAlaGln]' human Homo sapiens Human direct interaction direct interaction