DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Substrate protein folds while it is bound to the ATP-independent chaperone Spy. Substrate protein folds while it is bound to the ATP-independent chaperone Spy. Nature structural & molecular biology 2016 imex curation Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. DIP original experiment: DIP-268794X Nature structural & molecular biology 2016 IMEx Substrate protein folds while it is bound to the ATP-independent chaperone Spy. Substrate protein folds while it is bound to the ATP-independent chaperone Spy. Substrate protein folds while it is bound to the ATP-independent chaperone Spy. Nature structural & molecular biology 2016 imex curation Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Stull F., Koldewey P., Humes JR., Radford SE., Bardwell JC. DIP original experiment: DIP-268793X Nature structural & molecular biology 2016 IMEx Substrate protein folds while it is bound to the ATP-independent chaperone Spy. spy_ecoli Periplasmic chaperone Spy Spheroplast protein Y JW1732 b1743 spy protein protein ecoli Escherichia coli (strain K12) MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE DIP protein P77754 original sequence version: 103 B4733B967FC5F5BD imm7_ecolx Colicin-E7 immunity protein imm ceiE7 ImmE7 Microcin-E7 immunity protein protein protein ecolx Escherichia coli MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG DIP protein Q03708 original sequence version: 77 DIP protein Q03708 original sequence version: 58 DIP protein Q03708 original sequence version: 82 2CA7D97057529335 imm-spy-1 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction imm-spy-2 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction