DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267963X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267968X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267966X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267961X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267964X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267971X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267970X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267962X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267965X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267969X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. Nature structural & molecular biology 2015 imex curation Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wan B., Tang T., Upton H., Shuai J., Zhou Y., Li S., Chen J., Brunzelle JS., Zeng Z., Collins K., Wu J., Lei M. DIP original experiment: DIP-267967X Nature structural & molecular biology 2015 IMEx The Tetrahymena telomerase p75-p45-p19 subcomplex is a unique CST complex. tap19_tetts Telomerase-associated protein of 19 kDa TAP19 TTHERM_00658760 protein protein tetts Tetrahymena thermophila (strain SB210) MQQPKRNFDLYKLITDKQIDFQVADLIQDEQSSFVSVRIYGQFKCFVPKSTIQEQLDKIKNLSSKELAKNKIFKFLSEYNKNNQKQDELSHDYYGYFKVQQHQFILNLENAQREASLAVDDFYFINGRIYKTNHDILILQAHHVYQMQKPTLQLLQAASEINQN DIP protein I7MM24 original sequence version: 7 591F49EFC6915CFA tap75_tetts Telomerase-associated protein of 75 kDa TAP75 TTHERM_00059040 protein protein tetts Tetrahymena thermophila (strain SB210) MEIEEDLNLKILEDVKKLYLQSFDYIKNGISSSLPSDKKFLADDDIDLSRITFLYKFISVNPTLLLINEKTQAKRRIFQGEYLYGKKKIQFNIIAKNLEIERELIQFFKKPYQCYIMHNVQVFQMLNKNKNNNVVEFMDSEDLQSSVDCQLYYLIDESSHVLEDDSMDFISTLTRLSDSFNSNEFVFETNYSIQISQMPKPLNTTHFKLLQPKVVNSFEGVILQVQEGKNILQIEELIDQVYLNSRRDRFYILKVANGKNYMDFIEVYLVYDNEDQEAKQQLQFYLKPFQRILIFQSLKHFTKNLKLFMISFFYSSGVQPNNSNVKNFLVSHKGVEFFSRFDIQKNELLCKDLIKSYNKLPLSNISKLLEDEGVMIRSNMKFQVRVKKVKYFKIRLNCLNCKQEWTVGLKNCINCKGQQSYISYNIQVLVQDQHFLEQQAYIYLYDDLAAQFFNITESEKKELHLHLTKNETFIQLYYSFNKDYPLSIIKFKDKIFNKDITNCIVAYPFADIDNKIFNSQQQIIQDENLRIESEKFIQNFTEDNNLQESKLYYEKFKSKNKQQIFVNGTYISTNYSQGQKICLKPIPCLKVMYVFPQEDIKLSALKIIEEINQLKIQIDQLN DIP protein I7MHB0 original sequence version: 13 tap45_tetts Telomerase-associated protein of 45 kDa TAP45 TTHERM_00083360 protein protein tetts Tetrahymena thermophila (strain SB210) MEDNFELVFLKELPSLPDFSKVCFTGLILSFSNFPSSEQNQQKDVPHKIAIIQDSTGEAELFLDMYKFCQEEISVFKAITGIGVLKKKNIGAGQVCKIIVERFRIIHSADEEMLQYLLIQKYKLSKTLNEQQQIKQKEQQINQQKIDKVVQDKESKEHLLWKQQQIPQIKSNQENINTLKYKELIAGELMRITHKLLIQKLQQQQPANNNKQINEMDVESNELAEKKEVIIKIQEIAKDQQLYDTLSIQYQVDQKEQYYAKIAQSLEDFVSISALKMVSYIYPNISYQVSIGFFQNILDIATKTVKDRGALGCNYKYLKDKLTKALNLQQISYPLISESYISYLVHLFQDFNIIEIENEHKFYYKQAFQYDDS DIP protein Q237B3 original sequence version: 27 tap19-tap45-4 9 14 unspecified role unspecified role prey prey Region 2-129 Region 2-129 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role bait bait Region 7-162 Region 7-162 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association tap75-tap19-1 10 13 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association tap19-tap45-5 4 14 unspecified role unspecified role prey prey Region 2-129 Region 2-129 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tap19-tap45-6 1 14 unspecified role unspecified role unspecified role unspecified role Region 2-129 Region 2-129 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 7-162 Region 7-162 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tap19-tap45-7 11 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association tap19-tap45-8 8 14 unspecified role unspecified role unspecified role unspecified role Region 2-129 Region 2-129 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 7-162 Region 7-162 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tap45-tap19-1 5 14 unspecified role unspecified role bait bait Region 2-129 Region 2-129 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Region 7-162 Region 7-162 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association tap75-tap45-1 3 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey Region 2-129 Region 2-129 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tap19-tap45-9 2 13 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association tap45-tap19-2 7 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 12 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined D2CVN7:p.Arg38Glu R38E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R38E'. Wed May 02 20:02:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg38glu' Tue Jun 30 20:10:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg38Glu' D2CVN7:p.Tyr145Ala Y145A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y145A'. Wed May 02 19:36:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr145ala' Tue Jun 30 17:44:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr145Ala' D2CVN7:p.Met147Trp M147W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M W This feature has been corrected as a result of our quality control procedures. The original label was 'M147W'. Wed May 02 19:04:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met147trp' Tue Jun 30 15:59:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met147Trp' D2CVN7:p.Ile161Arg I161R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I R This feature has been corrected as a result of our quality control procedures. The original label was 'I161R'. Wed May 02 18:22:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile161arg' Tue Jun 30 19:58:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile161Arg' in vitro In vitro physical association physical association tap19-tap45-10 6 14 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6JXI5:p.Ala109Arg A109R/W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A R Wed May 02 17:41:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala109arg' Tue Jun 30 19:05:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala109Arg' Q6JXI5:p.Glu112Arg E112R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E112R'. Wed May 02 18:07:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu112arg' Tue Jun 30 16:59:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu112Arg' Q6JXI5:p.Met113Trp M113W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M W This feature has been corrected as a result of our quality control procedures. The original label was 'M113W'. Wed May 02 15:24:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met113trp' Tue Jun 30 17:34:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met113Trp' Q6JXI5:p.Ala109Trp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A W Wed May 02 19:24:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala109trp' Tue Jun 30 17:32:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala109Trp' in vitro In vitro 12 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro physical association physical association