DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267179X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267181X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267177X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267175X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267172X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267173X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267165X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267169X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267170X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267178X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267171X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267176X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267166X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267174X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267168X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267180X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267167X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Autophagy mediates degradation of nuclear lamina. Nature 2015 imex curation Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dou Z., Xu C., Donahue G., Shimi T., Pan JA., Zhu J., Ivanov A., Capell BC., Drake AM., Shah PP., Catanzaro JM., Ricketts MD., Lamark T., Adam SA., Marmorstein R., Zong WX., Johansen T., Goldman RD., Adams PD., Berger SL. DIP original experiment: DIP-267182X Nature 2015 IMEx Autophagy mediates degradation of nuclear lamina. sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q13501 original sequence version: 139 DIP protein Q13501 original sequence version: 142 DIP protein Q13501 original sequence version: 163 DIP protein Q13501 original sequence version: 146 DIP protein Q13501 original sequence version: 162 DIP protein Q13501 original sequence version: 155 DIP protein Q13501 original sequence version: 140 462D94C171F337CD mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F q9h492-1 Microtubule-associated proteins 1A/1B light chain 3A MAP1LC3A Autophagy-related protein LC3 A Autophagy-related ubiquitin-like modifier LC3 A MAP1 light chain 3-like protein 1 MAP1A/MAP1B light chain 3 A Microtubule-associated protein 1 light chain 3 alpha protein protein human Homo sapiens Human MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF DIP protein Q9H492-1 original sequence version: 108 DIP protein Q9H492 original sequence version: 124 DIP protein Q9H492 original sequence version: 128 p02545-1 Prelamin-A/C Lamin A LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM DIP protein P02545-1 original sequence version: 207 DIP protein P02545 original sequence version: 211 DIP protein P02545 original sequence version: 159 E0855F7699F0318B mlp3c_human Microtubule-associated proteins 1A/1B light chain 3C MAP1LC3C Microtubule-associated protein 1 light chain 3 gamma MAP1A/MAP1B light chain 3 C MAP1 light chain 3-like protein 3 Autophagy-related protein LC3 C Autophagy-related ubiquitin-like modifier LC3 C protein protein human Homo sapiens Human MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLEDRPCNPL DIP protein Q9BXW4 original sequence version: 92 DIP protein Q9BXW4 original sequence version: 111 D3DFA8EE5985C3AA lmnb2_human Lamin-B2 LMNB2 LMN2 protein protein human Homo sapiens Human MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM DIP protein Q03252 original sequence version: 160 DIP protein Q03252 original sequence version: 115 A8799BB12B6242B9 lmnb1_human Lamin-B1 LMNB1 LMN2 LMNB protein protein human Homo sapiens Human MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM DIP protein P20700 original sequence version: 162 DIP protein P20700 original sequence version: 167 DIP protein P20700 original sequence version: 121 73292877745722C4 gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL DIP protein O95166 original sequence version: 109 DIP protein O95166 original sequence version: 112 DIP protein O95166 original sequence version: 128 DIP protein O95166 original sequence version: 132 BC0B84B8A51C1E32 map1lc3b-lmnb1-1 12 25 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association map1lc3b-lmnb1-2 7 25 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association map1lc3c-lmnb1-1 2 23 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 25 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction map1lc3b-lmnb1-3 8 25 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9GZQ8:p.Gly120Ala G120A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G120A'. Wed May 02 17:35:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly120ala' Tue Jun 30 17:50:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120Ala' human Homo sapiens Human physical association physical association map1lc3b-lmnb1-4 5 19 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 370-458 Region 370-458 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 20 unspecified role unspecified role bait bait human Homo sapiens Human association association map1lc3b-lmnb1-5 3 25 unspecified role unspecified role prey prey Region 370-458 Region 370-458 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction map1lc3b-lmnb1-6 13 25 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-28 Region 1-28 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R10A/R11A'. Wed May 02 15:28:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg10ala,arg11ala' Tue Jun 30 17:54:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg10Ala;Arg11Ala]' ecolx Escherichia coli direct interaction direct interaction map1lc3b-lmnb1-7 9 25 unspecified role unspecified role prey prey Region 370-458 Region 370-458 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P20700:p.[Ser393Ala;Ser395Ala;Ser396Ala;Arg397Ala] S393A/S395A/S396A/R397A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S393A/S395A/S396A/R397A'. Wed May 02 20:20:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser393ala,ser395ala,ser396ala,arg397ala' Tue Jun 30 20:07:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser393Ala;Ser395Ala;Ser396Ala;Arg397Ala]' P20700:p.Val398Ala V398A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V398A'. Wed May 02 15:13:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val398ala' Tue Jun 30 17:08:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val398Ala' P20700:p.[Ser393Ala;Ser395Ala;Ser396Ala;Arg397Ala;Val398Ala] S393A/S395A/S396A/R397A/V398A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S393A/S395A/S396A/R397A/V398A'. Wed May 02 18:32:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser393ala,ser395ala,ser396ala,arg397ala,val398ala' Tue Jun 30 18:26:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser393Ala;Ser395Ala;Ser396Ala;Arg397Ala;Val398Ala]' P20700:p.[Ser395Ala;Ser396Ala] S395A/S396A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S395A/S396A'. Wed May 02 17:07:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser395ala,ser396ala' Tue Jun 30 19:06:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser395Ala;Ser396Ala]' P20700:p.[Ser396Ala;Arg397Ala] S396A/R397A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S396A/R397A'. Wed May 02 15:56:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser396ala,arg397ala' Tue Jun 30 17:02:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser396Ala;Arg397Ala]' P20700:p.[Ser393Ala;Ser395Ala] S393A/S395A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S393A/S395A'. Wed May 02 19:23:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser393ala,ser395ala' Tue Jun 30 18:35:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser393Ala;Ser395Ala]' in vitro In vitro 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction map1lc3a-lmnb1-1 16 21 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 25 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction lmnb1-map1lc3b-1 6 25 unspecified role unspecified role unspecified role unspecified role cVenus-tag cVenus-tag c-venus c-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role unspecified role unspecified role Q9GZQ8:p.Gly120Ala G120A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G120A'. Wed May 02 20:04:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly120ala' Tue Jun 30 16:36:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120Ala' nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R10A/R11A'. Wed May 02 14:39:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg10ala,arg11ala' Tue Jun 30 20:08:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg10Ala;Arg11Ala]' human Homo sapiens Human physical association physical association map1lc3b-lmnb1-8 17 25 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association lmnb1-lmna-1 10 22 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association map1lc3b-lmnb1-9 14 25 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role bait bait Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R10A/R11A'. Wed May 02 15:10:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg10ala,arg11ala' Tue Jun 30 19:50:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg10Ala;Arg11Ala]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association lmnb1-lmna-2 15 24 unspecified role unspecified role prey prey human Homo sapiens Human 22 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role bait bait human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human association association map1lc3b-lmnb1-10 4 25 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role bait bait Q9GZQ8:p.[Arg10Ala;Arg11Ala] R10A/R11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R10A/R11A'. Wed May 02 15:20:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg10ala,arg11ala' Tue Jun 30 15:53:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg10Ala;Arg11Ala]' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association map1lc3b-lmnb1-11 1 25 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association gabarap-lmnb1-1 18 26 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 25 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction map1lc3b-lmnb1-12 11 19 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 20 unspecified role unspecified role bait bait human Homo sapiens Human association association