DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. Structure (London, England : 1993) 2015 imex curation Murphy JM., Nakatani Y., Jamieson SA., Dai W., Lucet IS., Mace PD. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Murphy JM., Nakatani Y., Jamieson SA., Dai W., Lucet IS., Mace PD. DIP original experiment: DIP-267319X Structure (London, England : 1993) 2015 IMEx Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. Structure (London, England : 1993) 2015 imex curation Murphy JM., Nakatani Y., Jamieson SA., Dai W., Lucet IS., Mace PD. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Murphy JM., Nakatani Y., Jamieson SA., Dai W., Lucet IS., Mace PD. DIP original experiment: DIP-267320X Structure (London, England : 1993) 2015 IMEx Molecular Mechanism of CCAAT-Enhancer Binding Protein Recruitment by the TRIB1 Pseudokinase. p49715-1 CCAAT/enhancer-binding protein alpha CEBPA CEBP protein protein human Homo sapiens Human MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA DIP protein P49715-1 original sequence version: 151 q96ru8-1 Tribbles homolog 1 TRIB1 C8FW GIG2 TRB1 G-protein-coupled receptor-induced gene 2 protein SKIP1 protein protein human Homo sapiens Human MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSFFC DIP protein Q96RU8-1 original sequence version: 121 cebpa-trib1-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 53-75 Region 53-75 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 84-343 Region 84-343 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction trib1-cebpa-1 2 3 unspecified role unspecified role prey prey Region 53-75 Region 53-75 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P49715-1:p.Ile55Ala I55A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I55A'. Wed May 02 20:19:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile55ala' Tue Jun 30 16:58:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile55Ala' P49715-1:p.Glu59Ala E59A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E59A'. Wed May 02 16:59:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu59ala' Tue Jun 30 16:33:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu59Ala' P49715-1:p.Ser61Ala S61A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S61A'. Wed May 02 14:56:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser61ala' Tue Jun 30 20:26:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser61Ala' P49715-1:p.Ile62Asp I62D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I62D'. Wed May 02 17:36:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile62asp' Tue Jun 30 19:22:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile62Asp' P49715-1:p.Ile64Asp I64D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I64D'. Wed May 02 19:16:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile64asp' Tue Jun 30 19:31:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile64Asp' P49715-1:p.Tyr67Ala Y67A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y67A'. Wed May 02 15:27:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr67ala' Tue Jun 30 17:13:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr67Ala' P49715-1:p.Ile68Asp I68D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I D This feature has been corrected as a result of our quality control procedures. The original label was 'I68D'. Wed May 02 16:47:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile68asp' Tue Jun 30 16:08:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile68Asp' ecolx Escherichia coli 4 unspecified role unspecified role bait bait Region 84-343 Region 84-343 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction