DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269187X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269192X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269191X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269189X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269186X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269193X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269183X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269190X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269185X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269184X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Sestrin2 is a leucine sensor for the mTORC1 pathway. Science (New York, N.Y.) 2016 imex curation Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wolfson RL., Chantranupong L., Saxton RA., Shen K., Scaria SM., Cantor JR., Sabatini DM. DIP original experiment: DIP-269188X Science (New York, N.Y.) 2016 IMEx Sestrin2 is a leucine sensor for the mTORC1 pathway. sesn1_human Sestrin-1 SESN1 PA26 SEST1 p53-regulated protein PA26 protein protein human Homo sapiens Human MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRYMT DIP protein Q9Y6P5 original sequence version: 125 wdr24_human GATOR complex protein WDR24 WDR24 C16orf21 WD repeat-containing protein 24 JFP7 protein protein human Homo sapiens Human MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLVAAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS DIP protein Q96S15 original sequence version: 119 6C109240F6251898 sesn3_human Sestrin-3 SESN3 SEST3 protein protein human Homo sapiens Human MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTNFLVEEYSTSGRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAEWLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLANDNNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEEASQEEMSTRFEKEKKESLFVVSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDYDYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRHLT DIP protein P58005 original sequence version: 111 sesn_drome Sestrin homolog CG11299 Sesn protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYYAVDYYADMGQISQDCFAATQTGASDFDMDELDDLDQVTQVIGYHPQFHDHFLATQNFIMKGDGPLPNDYRYYLAIIAAARHQCPYLVKRYEKEFINQGGDSAWLGGLDFIPAKLRAIYDINKILAHRPWLLRKEHIERLTKGKNSWSLSEVVHAMVLLSHFHSLSSFVFSCGLTQKLDGLSSPKLKSPPAAVAALAPTILITPTSPTEPQKGKPVLAEISLNNANPDYDSQTAASSNGGAPPDSANAVADGPDATTLNGYLATAQQLPQQHGISVETLMERMKVLSQKQDECSEAELSSRFQKVEQQTAELAAVTPEAAVGVPTNLSHYVDDANFIYQDFARRGTESINTFRIQDYSWEDHGYSLVDGLYNDVGIFLDAKFRAAYNLTYCTMGGIKNVDTSKFRRAIWNYIQCIYGIRHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEARNQAELLYALREIMRYMT DIP protein Q9W1K5 original sequence version: 117 39AC03B8F653CA30 sesn2_human Sestrin-2 SESN2 SEST2 Hi95 Hypoxia-induced gene protein protein human Homo sapiens Human MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT DIP protein P58004 original sequence version: 125 9C13371316D84060 mio_human GATOR complex protein MIOS MIOS Missing oocyte meiosis regulator homolog protein protein human Homo sapiens Human MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVKLSAGETETTLLVTKPLYELGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDMDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQSDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP DIP protein Q9NXC5 original sequence version: 111 481D3AA0C9A3A1CB wdr24-sesn2-1 9 16 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association wdr24-mios-1 7 17 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association wdr24-sesn2-2 1 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association wdr24-mios-2 4 17 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association wdr24-sesn1-1 8 12 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association wdr24-sesn3-1 3 14 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sesn-wdr24-1 6 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sesn2-wdr24-1 5 16 unspecified role unspecified role bait bait P58004:p.Ser190Trp S190W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S W This feature has been corrected as a result of our quality control procedures. The original label was 'S190W'. Wed May 02 18:27:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser190trp' Tue Jun 30 19:03:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser190Trp' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association wdr24-mios-3 10 17 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association wdr24-mios-4 11 17 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human association association sesn2-wdr24-2 2 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association