DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A brain circuit that synchronizes growth and maturation revealed through Dilp8 binding to Lgr3. A brain circuit that synchronizes growth and maturation revealed through Dilp8 binding to Lgr3. Science (New York, N.Y.) 2015 imex curation Vallejo DM., Juarez-Carreño S., Bolivar J., Morante J., Dominguez M. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Vallejo DM., Juarez-Carreño S., Bolivar J., Morante J., Dominguez M. DIP original experiment: DIP-268188X Science (New York, N.Y.) 2015 IMEx A brain circuit that synchronizes growth and maturation revealed through Dilp8 binding to Lgr3. q9vbp0_drome CT16193 DLGR3 Dmel\CG31096 anon-WO0170980.25 anon-WO0170980.26 dLGR3 lgr3 Dmel_CG31096 CG5042 CG5046 CG31096 Lgr3 Lgr3-RA protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVYGRSIAVGFCLMTVVLLLAAVIFYLSLGPCPAASFACDNGTLCVPRRQMCDSRNDCADSSDENPVECGLLYGSKEIADKIVRNAIEKKQQRLISAVSNASGADSTTSMVPRNQSLTLNMTCDIVTYPKACQCGQGTILYCGRYAKLRRFPRLSSEVTNLIIIRNNLTLRDNIFANFTRLQKLTLKYNNISRVPLGSFSGLFHLERLELSHNNVSHLPHGVFLGLHSLQWLFLVNNHLHHLPVEQLRFFRRLEWLVLSRNRLTLRNVQLPKIPTLYEVYLDFNRIEYIGEETFSQLDNLHLLDLQHNLITHIHGRAFANLTNMRDIRLVGNPIKELSGETFLHNTRLEALSLALMPIHISSSLMEPLNISFLNLTGIRYDHIDFEAINSMRNLTYIIYDRFFYCSMTPRVRMCKPSTDGVSSFQDLLSKPVLRYSAWVMATLTIAGNVLVLWGRFIYRDENVAVTMVIRNLALADMLMGFYLVTIGVQDYRYRNEYYKVVLDWITSWQCTLIGTLAVSSSEVSMLILAFMSLERFLLIADPFRGHRSIGNRVMWLALICIWITGVGLAVAPVLLWRTSTLPYYGSYSGTCFPLHIHEAFPMGWLYSAFVFLGVNLLLLVMIAMLYTALLISIWRTRSATPLTLLDCEFAVRFFFIVLTDFLCWVPIIVMKIWVFFNYNISDDIYAWLVVFVLPLNSAVNPLLYTFTTPKYRNQIFLRGWKKITSRKRAEAGNGNVATTTTGTATGSSQHPDDFTIFAKAAMRCH DIP protein Q9VBP0 original sequence version: 116 q4v5v6_drome Ilp8 dILP-8 DILP8 Dilp8 dILP8 dilp8 dlip8 Dmel\CG14059 DILP 8 Lgr3 ilp8 CG14059 Dmel_CG14059 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSKLHMCRWMLLVIGVCCLMGSSSGSFCSLERMKKFAMEACEHLFQADEGARRDRRSIEFAHHHLNRLGSGKTHNKHHYISRSSYPMGGYLKVTREHFNRLSELDIFPRYKPIKPHHEKKHRFKRDHSSRSYNNIPYCCLNQCEEEFFC DIP protein Q4V5V6 original sequence version: 70 ilp8-lgr3-1 1 3 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 2 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-433 Region 1-433 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association