DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. Science (New York, N.Y.) 2015 imex curation Lau L., Gray EE., Brunette RL., Stetson DB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lau L., Gray EE., Brunette RL., Stetson DB. DIP original experiment: DIP-268180X Science (New York, N.Y.) 2015 IMEx DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. Science (New York, N.Y.) 2015 imex curation Lau L., Gray EE., Brunette RL., Stetson DB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lau L., Gray EE., Brunette RL., Stetson DB. DIP original experiment: DIP-268181X Science (New York, N.Y.) 2015 IMEx DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. Science (New York, N.Y.) 2015 imex curation Lau L., Gray EE., Brunette RL., Stetson DB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lau L., Gray EE., Brunette RL., Stetson DB. DIP original experiment: DIP-268182X Science (New York, N.Y.) 2015 IMEx DNA tumor virus oncogenes antagonize the cGAS-STING DNA-sensing pathway. sting_human Stimulator of interferon genes protein STING1 ERIS Endoplasmic reticulum interferon stimulator MITA Mediator of IRF3 activation TMEM173 Transmembrane protein 173 protein protein human Homo sapiens Human MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS DIP protein Q86WV6 original sequence version: 83 DIP protein Q86WV6 original sequence version: 47 DIP protein Q86WV6 original sequence version: 50 DIP protein Q86WV6 original sequence version: 100 DIP protein Q86WV6 original sequence version: 68 CB54D6A4D4D8E7C0 ve7_hpv18 Protein E7 E7 protein protein hpv18 Human papillomavirus type 18 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ DIP protein P06788 original sequence version: 78 2CDB119534D0186A e1a_ade05 Early E1A protein Early E1A 32 kDa protein protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP DIP protein P03255 original sequence version: 73 DIP protein P03255 original sequence version: 110 8C5997A3908C40D7 tmem173-e7-1 3 5 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tmem173-e1a_ade05-1 1 6 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tmem173-e1a_ade05-2 2 6 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P03255:p.[Leu122Val;Cys124Ser;Glu126Asp] L122V/C124S/E126D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E D certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain L V This feature has been corrected as a result of our quality control procedures. The original label was 'L122V/C124S/E126D'. Wed May 02 17:31:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu122val,cys124ser,glu126asp' Tue Jun 30 17:19:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu122Val;Cys124Ser;Glu126Asp]' human Homo sapiens Human 4 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association