DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Structure (London, England : 1993) 2015 imex curation Han Q., Zhou C., Wu S., Liu Y., Triplett L., Miao J., Tokuhisa J., Deblais L., Robinson H., Leach JE., Li J., Zhao B. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Han Q., Zhou C., Wu S., Liu Y., Triplett L., Miao J., Tokuhisa J., Deblais L., Robinson H., Leach JE., Li J., Zhao B. DIP original experiment: DIP-267288X Structure (London, England : 1993) 2015 IMEx Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Structure (London, England : 1993) 2015 imex curation Han Q., Zhou C., Wu S., Liu Y., Triplett L., Miao J., Tokuhisa J., Deblais L., Robinson H., Leach JE., Li J., Zhao B. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Han Q., Zhou C., Wu S., Liu Y., Triplett L., Miao J., Tokuhisa J., Deblais L., Robinson H., Leach JE., Li J., Zhao B. DIP original experiment: DIP-267290X Structure (London, England : 1993) 2015 IMEx Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. Structure (London, England : 1993) 2015 imex curation Han Q., Zhou C., Wu S., Liu Y., Triplett L., Miao J., Tokuhisa J., Deblais L., Robinson H., Leach JE., Li J., Zhao B. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Han Q., Zhou C., Wu S., Liu Y., Triplett L., Miao J., Tokuhisa J., Deblais L., Robinson H., Leach JE., Li J., Zhao B. DIP original experiment: DIP-267289X Structure (London, England : 1993) 2015 IMEx Crystal Structure of Xanthomonas AvrRxo1-ORF1, a Type III Effector with a Polynucleotide Kinase Domain, and Its Interactor AvrRxo1-ORF2. q6tkr9_9xant protein protein xanthomonas oryzae pv. oryzicola Xanthomonas oryzae pv. oryzicola MKTLTGADALEFHKKLKERNKALHASDLELALVHADAVGKERFDLEELEKICDTSDAGRLTDAKERNDIYERMYYVEYPNVMTLKEFAHIVETLFSWS DIP protein Q6TKR9 original sequence version: 13 q6tkr8_9xant protein protein xanthomonas oryzae pv. oryzicola Xanthomonas oryzae pv. oryzicola MKNKTDIAGIAGLSTSHVSFDDAESKSVLDGSTQSTPEYKFQTPLDQLPARPAGPKSSNTTDAYIHESLPHSVPIAGASTSAVTHQQATQRKGTDEIYGLGSLPSAGPGRWEYLANPGNWHPERRKLHEKLLDQARSSALTLAESLESDGCQPTLFALRGNTATGKTRIATKKIPVLAAALKKTAGKGCVNPDVFKSSLAKSETGAKIFSSAQVHSESSFLADRFEGGLRSQKTGSGAIASIVVDKRLSREYEIDSYIQLAKETGRKVELCDIDAPLENSLVGVLQRKPEGEDPRPPYPVVSSGFVAVRSNRMYVIDRFIADPSLGNYRLFGTAEDGEKVMVASVIGGEFSVENAELYEKITSPQLSVTGDLADKVIDKELIDRLENNIADPERAAKTRAALEKYSGKSWSAALAAHSELI DIP protein Q6TKR8 original sequence version: 27 q6tkr8_9xant-q6tkr9_9xant-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 65-421 Region 65-421 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q6tkr8_9xant-q6tkr9_9xant-2 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 65-421 Region 65-421 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q6tkr8_9xant-q6tkr9_9xant-3 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 65-421 Region 65-421 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction