UniProt UniProt http://www.uniprot.org Mechanisms of inhibition and potentiation of α4β2 nicotinic acetylcholine receptors by members of the Ly6 protein family. Mechanisms of inhibition and potentiation of α4β2 nicotinic acetylcholine receptors by members of the Ly6 protein family. The Journal of biological chemistry 2015 imex curation Wu M., Puddifoot CA., Taylor P., Joiner WJ. wjoiner@ucsd.edu 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wu M., Puddifoot CA., Taylor P., Joiner WJ. Chrna4/alpha-4 constructs according Ref. 43 (PMID 21187334) wjoiner@ucsd.edu Accepted 2017-MAY-15 AT 08:54 BST AT 08:54 BST by MGT The Journal of biological chemistry 2015 imex curation ly6h_mouse Lymphocyte antigen 6H Ly6h protein protein mouse Mus musculus Mouse MLPAAMKSLGLALLALLLCPSPAHGLWCQDCTLANSSHCAPKQCQPTDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGASVAGRSPWALAGGLLLSLGPALLWAGP FDEEC13591EF219C acha4_mouse Neuronal acetylcholine receptor subunit alpha-4 Chrna4 Acra4 protein protein mouse Mus musculus Mouse MEIGGSGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPESEPGILGDICNQGLSPAPTFCNRMDTAVETQPTCRSPSHKVPDLKTSEVEKASPCPSPGSCHPPNSSGAPVLIKARSLSVQHVPSSQEAAEGSIRCRSRSIQYCVSQDGAASLTESKPTGSPASLKTRPSQLPVSDQTSPCKCTCKEPSPVSPITVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI DIP protein O70174 original sequence version: 90 261455B6ED50B41C lypd1_mouse Ly6/PLAUR domain-containing protein 1 Lypd1 Lypdc1 MNCb-0671 Ly-6/neurotoxin-like protein 2 protein protein mouse Mus musculus Mouse MWVLGIAATFCGLFWLPGLALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASAIRPGLLTTLLFFHLALCLAHC DIP protein Q8BLC3 original sequence version: 56 51717F7922C02DAA achb2_mouse Neuronal acetylcholine receptor subunit beta-2 Chrnb2 protein protein mouse Mus musculus Mouse MARCSNSMALLFSFGLLWLCSGVLGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGTLFFREGPAADPCTCFVNPASMQGLAGAFQAEPAAAGLGRSMGPCSCGLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTATTFLHSDHSAPSSK DIP protein Q9ERK7 original sequence version: 69 7FFAD47BD86B4493 ly6e_mouse Lymphocyte antigen 6E Ly6e Ly67 Sca-2 Tsa-1 Stem cell antigen 2 Thymic shared antigen 1 protein protein mouse Mus musculus Mouse MSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP 5A1CBBE1464DC029 ly66e_mouse Lymphocyte antigen 6G6e Ly6g6e Lymphocyte antigen 6 complex locus protein G6e protein protein mouse Mus musculus Mouse MGPSSAFLGVLFLSGTLGLTTSPARGRLRCYTCSFAKPCDPVPRECREDEVCGVSVGTSGRTLVRWPFSRWLLSFLPMAAAATSAFLFCPTEQKEEEVIERKGCLPRAQCPLLGHATYWSRSYSLRHQCCEQDLCNAAASQPPPNLPLMTLLPLAAMIGWGVHDFL DF4318A83864D808 chrna4-lypd1-1 1 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association 2A and C chrna4-ly6h-1 1 2 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association 2A chrna4-ly6e-1 1 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association 2A chrna4-chrnb2-1 1 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role ancillary ancillary nucl transfection nucleic acid transfection nucl transfection physical association physical association 2B chrna4-lypd1-2 1 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag range range range range 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag certain certain sequence position certain certain certain sequence position certain physical association physical association 2C