DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Nature 2015 imex curation Lin DY., Huang S., Chen J. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Lin DY., Huang S., Chen J. DIP original experiment: DIP-265982X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Nature 2015 imex curation Lin DY., Huang S., Chen J. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by staining molecular weight estimation by staining weight by staining Lin DY., Huang S., Chen J. DIP original experiment: DIP-265984X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Nature 2015 imex curation Lin DY., Huang S., Chen J. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lin DY., Huang S., Chen J. DIP original experiment: DIP-265980X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Nature 2015 imex curation Lin DY., Huang S., Chen J. Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Lin DY., Huang S., Chen J. DIP original experiment: DIP-265983X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Crystal structures of a polypeptide processing and secretion transporter. Nature 2015 imex curation Lin DY., Huang S., Chen J. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Lin DY., Huang S., Chen J. DIP original experiment: DIP-265981X Nature 2015 IMEx Crystal structures of a polypeptide processing and secretion transporter. a3dcu1_acet2 Cthe_0534 protein protein cloth Clostridium thermocellum (strain ATCC 27405 / DSM 1237) Ruminiclostridium thermocellum MLRRLFKKKYVCVRQYDLTDCGAACLSSIAQYYGLKMSLAKIREMTGTDTQGTNAYGLIHAAKQLGFSAKGVKASKEDLLKDFRLPAIANVIVDNRLAHFVVIYSIKNRIITVADPGKGIVRYSMDDFCSIWTGGLVLLEPGEAFQKGDYTQNMMVKFAGFLKPLKKTVLCIFLASLLYTALGIAGSFYIKFLFDDLIKFEKLNDLHIISAGFAVIFLLQIFLNYYRSILVTKLGMSIDKSIMMEYYSHVLKLPMNFFNSRKVGEIISRFMDASKIRQAISGATLTIMIDTIMAVIGGILLYIQNSSLFFISFIIILLYGIIVTVFNKPIQNANRQIMEDNAKLTSALVESVKGIETIKSFGAEEQTEKSTRDKIETVMKSSFKEGMLYINLSSLTGIVAGLGGIVILWAGAYNVIKGNMSGGQLLAFNALLAYFLTPVKNLIDLQPLIQTAVVASNRLGEILELATEKELREDSDDFVISLKGDIEFRNVDFRYGLRKPVLKNINLTIPKGKTVAIVGESGSGKTTLAKLLMNFYSPEKGDILINGHSIKNISLELIRKKIAFVSQDVFIFSGTVKENLCLGNENVDMDEIIKAAKMANAHDFIEKLPLKYDTFLNESGANLSEGQKQRLAIARALLKKPDILILDEATSNLDSITENHIKDAIYGLEDDVTVIIIAHRLSTIVNCDKIYLLKDGEIVESGSHTELIALKGCYFKMWKQTENTLAS DIP protein A3DCU1 original sequence version: 64 a3dcu2_acet2 Cthe_0535 protein protein cloth Clostridium thermocellum (strain ATCC 27405 / DSM 1237) Ruminiclostridium thermocellum MSEAKKLNIGRELTDEELMEMTGGSTFSIQCQKDYTYKPSLPVVKYGVVIDEPEVVIKYGVGPIVGIKYGVEPIGPIQPMYGIKPVETLK DIP protein A3DCU2 original sequence version: 29 a3dcu1_cloth-1 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction a3dcu1_cloth-a3dcu2_cloth-1 5 7 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 6 enzyme enzyme unspecified role unspecified role Region 1-148 Region 1-148 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain A3DCU1:p.Cys21Ala C21A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C21A'. Wed May 02 18:07:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys21ala' Tue Jun 30 19:29:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys21Ala' A3DCU1:p.His99Ala H99A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H99A'. Wed May 02 16:04:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his99ala' Tue Jun 30 18:06:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His99Ala' ecolx Escherichia coli protein cleavage protein cleavage a3dcu1_cloth-a3dcu2_cloth-2 4 7 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait Region 1-148 Region 1-148 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction a3dcu2_cloth-a3dcu1_cloth-1 2 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey Region 1-148 Region 1-148 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction a3dcu1_cloth-a3dcu2_cloth-3 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction