DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Science (New York, N.Y.) 2015 imex curation Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266281X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Science (New York, N.Y.) 2015 imex curation Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down anti tag western anti tag western blot anti tag western Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266282X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Science (New York, N.Y.) 2015 imex curation Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266280X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. Science (New York, N.Y.) 2015 imex curation Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Ren R., Zhou X., He Y., Ke M., Wu J., Liu X., Yan C., Wu Y., Gong X., Lei X., Yan SF., Radhakrishnan A., Yan N. DIP original experiment: DIP-266279X Science (New York, N.Y.) 2015 IMEx PROTEIN STRUCTURE. Crystal structure of a mycobacterial Insig homolog provides insight into how these sensors monitor sterol levels. insi2_human Insulin-induced gene 2 protein INSIG2 protein protein human Homo sapiens Human MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE DIP protein Q9Y5U4 original sequence version: 77 DIP protein Q9Y5U4 original sequence version: 90 mint homomint 13E0392F1B30F08C scap_mouse Sterol regulatory element-binding protein cleavage-activating protein Scap Kiaa0199 protein protein mouse Mus musculus Mouse MTLTERLREKISQAFYNHGLLCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFSTPVKGYSPPPADSDHKQGEPSEQPEWYVGAPVAYIQQIFVKSSVSPWHRNLLAVDVFRSPLSRAFQLVEEIRNHVLRDSSGTKSLEEVCLQVTDLLPGLRKLRSLLPEHGCLLLSPGNFWQNDWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRMVSYTITLVFQRYHAKFLSSLRARLMLLHPSPNCSLRAENLVHVHFKEEIGIAELIPLVTTYIILFAYIYFSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNAATELGIILIGYFTLVPAIQEFCLFAVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPESCLPSAKPVGRPARYERQQAVRPSTPHTITLQPSSFRNLRLPKRLRVIYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLRTYLAAQVTEQSPLGEGSLGPMPVPSGVLPASHPDPAFSIFPPDAPKLPENQTLPGELPEHAGPAEGVHDSRAPEVTWGPEDEELWRKLSFRHWPTLFNYYNITLAKRYISLLPVIPVTLHLNPREALEGRHPQDGRSAWAPQEPLPAGLWESGPKGPGGTQTHGDITLYKVAALGLAAGIVLVLLLLCLYRVLCPRNYGQPGGGPGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIECLASDGMLLVSCCLAGQVCVWDAQTGDCLTRIPRPGPRRDSCGGGAFETQENWERLSDGGKASPEEPGDSPPLRRRPRGPPPPSLFGDQPDLTCLIDTNFSVQLPPEPTQPEPRHRVGCGRSRDSGYDFSRLVQRVYQEEGLAAMRMPALRPPSPGPPLPQASQEEGTAPEKGSPPLAWTPSTAGSIWSLELQGNLIVVGRSSGRLEVWDAIEGVLCCSNEEISSGITALVFLDRRIVAARLNGSLDFFSLETHTSLSPLQFRGTPGRGSSPSSSVYSSSNTVTCHRTHTVPCAHQKPITALRAAAGRLVTGSQDHTLRVFRLDDSCCLFTLKGHSGAITAVYIDQTMVLASGGQDGAICLWDVLTGSRVSQTFAHRGDVTSLTCTASCVISSGLDDFISIWDRSTGIKLYSIQQDLGCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLVYVPSVLEKLD DIP protein Q6GQT6 original sequence version: 115 insig_mycvp INSIG protein homolog Mvan_1475 protein protein mycvp Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) MRLRISEAVVLFLLGAVAALIGDHSHVVTGTTVYHTDAVPFVWSSPFWFPILVGAATASLAELRLHLPAPRDGVTARQALGGVAAVVGTYVTTALVHAFPVVPVTALVCAAAAITWCVLGDGPGAACGVVIAVIGPAVEIALVQLGVFAYHPDSDGLFGVAPFLAPLYFAFGVVAALLGELAVARRPQLGPPVCDTVSRGPGAG DIP protein A1T557 original sequence version: 40 a1t557_mycvp-1 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction a1t557_mycvp-2 3 7 unspecified role unspecified role unspecified role unspecified role A1T557:p.Arg77Cys R77C mutation mutation certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R77C'. Wed May 02 20:23:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg77cys' Tue Jun 30 19:15:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg77Cys' ecolx Escherichia coli direct interaction direct interaction a1t557_mycvp-3 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction insig2-scap-2 2 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9Y5U4:p.Phe115Ala F115A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F115A'. Wed May 02 17:21:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe115ala' Tue Jun 30 19:03:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe115Ala' Q9Y5U4:p.Trp145Ala W145A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W145A'. Wed May 02 16:09:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp145ala' Tue Jun 30 19:21:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp145Ala' Q9Y5U4:p.Asp149Ala D149A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D149A'. Wed May 02 19:57:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp149ala' Tue Jun 30 16:12:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp149Ala' Q9Y5U4:p.Ala113Trp A113W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A W This feature has been corrected as a result of our quality control procedures. The original label was 'A113W'. Wed May 02 19:07:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala113trp' Tue Jun 30 20:19:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala113Trp' Q9Y5U4:p.His120Phe H120F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H F This feature has been corrected as a result of our quality control procedures. The original label was 'H120F'. Wed May 02 17:15:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his120phe' Tue Jun 30 19:25:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His120Phe' Q9Y5U4:p.Gly117Phe G117F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G F This feature has been corrected as a result of our quality control procedures. The original label was 'G117F'. Wed May 02 18:10:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly117phe' Tue Jun 30 19:27:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly117Phe' Q9Y5U4:p.Gln132Ala Q132A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q132A'. Wed May 02 15:05:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln132ala' Tue Jun 30 20:11:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln132Ala' Q9Y5U4:p.Gly39Phe G39F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G F This feature has been corrected as a result of our quality control procedures. The original label was 'G39F'. Wed May 02 18:12:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly39phe' Tue Jun 30 17:27:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly39Phe' Q9Y5U4:p.Cys77Asp C77D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C D This feature has been corrected as a result of our quality control procedures. The original label was 'C77D'. Wed May 02 17:10:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys77asp' Tue Jun 30 16:05:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys77Asp' Q9Y5U4:p.Gly200Phe G200F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G F This feature has been corrected as a result of our quality control procedures. The original label was 'G200F'. Wed May 02 16:10:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly200phe' Tue Jun 30 15:59:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly200Phe' Q9Y5U4:p.Met203Trp M203W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M W This feature has been corrected as a result of our quality control procedures. The original label was 'M203W'. Wed May 02 16:32:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met203trp' Tue Jun 30 19:25:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met203Trp' Q9Y5U4:p.[Asn47Ala;Gln50Phe;Asn119Phe] N47A/Q50F/N119F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q F certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain N F This feature has been corrected as a result of our quality control procedures. The original label was 'N47A/Q50F/N119F'. Wed May 02 16:46:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn47ala,gln50phe,asn119phe' Tue Jun 30 19:13:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asn47Ala;Gln50Phe;Asn119Phe]' spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 6 unspecified role unspecified role prey prey Region 1-741 Region 1-741 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association