DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265842X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265833X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265844X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265839X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265841X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265846X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265835X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions human Homo sapiens Human light scattering light scattering predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265834X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265843X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265847X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265836X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay western blot western blot Immuno blot Immuno blot Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265849X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay western blot western blot Immuno blot Immuno blot Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265850X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265845X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265838X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265840X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay western blot western blot Immuno blot Immuno blot Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265848X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Structure (London, England : 1993) 2015 imex curation Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Couñago RM., Knapp KM., Nakatani Y., Fleming SB., Corbett M., Wise LM., Mercer AA., Krause KL. DIP original experiment: DIP-265837X Structure (London, England : 1993) 2015 IMEx Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. ccl2_human C-C motif chemokine 2 CCL2 MCP1 SCYA2 Small-inducible cytokine A2 Monocyte chemoattractant protein 1 Monocyte chemotactic protein 1 Monocyte chemotactic and activating factor Monocyte secretory protein JE HC11 protein protein human Homo sapiens Human MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT DIP protein P13500 original sequence version: 191 45EC72361435302F ccl3_human C-C motif chemokine 3 CCL3 G0S19-1 MIP1A SCYA3 Small-inducible cytokine A3 SIS-beta PAT 464.1 Macrophage inflammatory protein 1-alpha Tonsillar lymphocyte LD78 alpha protein G0/G1 switch regulatory protein 19-1 protein protein human Homo sapiens Human MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA DIP protein P10147 original sequence version: 169 mint Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) 517865D5D6776CA8 ccl5_human C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES protein protein human Homo sapiens Human MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS DIP protein P13501 original sequence version: 123 DIP protein P13501 original sequence version: 133 DIP protein P13501 original sequence version: 170 FB0BFAF9A87C620F cxcl2_mouse C-X-C motif chemokine 2 Cxcl2 Mip-2 Mip2 Scyb2 Macrophage inflammatory protein 2 protein protein mouse Mus musculus Mouse MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN DIP protein P10889 original sequence version: 126 plf4_mouse Platelet factor 4 Pf4 Cxcl4 Scyb4 C-X-C motif chemokine 4 protein protein mouse Mus musculus Mouse MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES DIP protein Q9Z126 original sequence version: 112 mint Platelet factor 4, non-covalently bound to a proteoglycan molecule, is released during platelet aggregation. PF4 neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes 94F0190EFACF1A6C plf4_human Platelet factor 4 PF4 CXCL4 SCYB4 C-X-C motif chemokine 4 Oncostatin-A Iroplact protein protein human Homo sapiens Human MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES DIP protein P02776 original sequence version: 156 E96C2EFE9B944D85 q2f862_orfv protein protein Orf virus Orf virus ORFV MKAVLLLALLGAFTNAAPLLESQRSNSEEKANFCSTHNDEVYARFRLQMRVGVRHSPLYTPSNMCMLDIEDSVEDIEESTEKEYASTATGEAAGVNVSVALVGEGVSIPFSYIGLGFNPSLEDSYLYVNVSSRAPWVKQTSDLSANGGWGIKQVLEKELLAIQIGCDNQKFPEEPTTTPPSPVTTTLSSTTPDLNEENTENTPTTTGASVDRKRNPADIDFSLLVDPRCVTSVDLHVELRDACIDYKQESPLSLKGKYGDGELVKKEIKDVGKNHNMCSLNLNPGN DIP protein Q2F862 original sequence version: 15 xcl1_human Lymphotactin XCL1 ATAC C motif chemokine 1 Cytokine SCM-1 LTN Lymphotaxin SCM-1-alpha SCYC1 Small-inducible cytokine C1 XC chemokine ligand 1 protein protein human Homo sapiens Human MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG DIP protein P47992 original sequence version: 132 DIP protein P47992 original sequence version: 72 DIP protein P47992 original sequence version: 138 FABA16063C3FC165 ccl7_human C-C motif chemokine 7 Small-inducible cytokine A7 Monocyte chemoattractant protein 3 Monocyte chemotactic protein 3 NC28 CCL7 MCP3 SCYA7 SCYA6 protein protein human Homo sapiens Human MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL DIP protein P80098 original sequence version: 146 96048B371C25D00E q2f862_orfv-1 2 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl2-q2f862_orfv-1 15 19 unspecified role unspecified role unspecified role unspecified role Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl7-q2f862_orfv-1 1 27 unspecified role unspecified role unspecified role unspecified role Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-xcl1-1 6 26 unspecified role unspecified role prey prey Region 22-114 Region 22-114 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 25 unspecified role unspecified role bait bait Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-2 8 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-cxcl2-1 13 22 unspecified role unspecified role prey prey Region 28-100 Region 28-100 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 25 unspecified role unspecified role bait bait Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl3-q2f862_orfv-1 4 20 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-3 7 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl2-q2f862_orfv-2 9 19 unspecified role unspecified role unspecified role unspecified role Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-pf4-1 10 23 unspecified role unspecified role prey prey Region 30-105 Region 30-105 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 25 unspecified role unspecified role bait bait Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl2-q2f862_orfv-3 11 19 unspecified role unspecified role unspecified role unspecified role Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl3-q2f862_orfv-2 16 20 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-ccl2-1 3 19 unspecified role unspecified role prey prey Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role bait bait Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-ccl5-1 17 21 unspecified role unspecified role prey prey Region 24-91 Region 24-91 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 25 unspecified role unspecified role bait bait Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl2-q2f862_orfv-4 18 19 unspecified role unspecified role unspecified role unspecified role Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction ccl7-q2f862_orfv-2 5 27 unspecified role unspecified role unspecified role unspecified role Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role unspecified role unspecified role Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-ccl7-1 14 27 unspecified role unspecified role prey prey Region 24-99 Region 24-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 25 unspecified role unspecified role bait bait Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction q2f862_orfv-pf4-2 12 24 unspecified role unspecified role prey prey Region 32-101 Region 32-101 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 25 unspecified role unspecified role bait bait Region 17-286 Region 17-286 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction