IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis. AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis. Oncotarget 2015 imex curation Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu Accepted 2017-DEC-01 AT 07:35 GMT AT 07:35 GMT by ORCHARD Oncotarget 2015 imex curation I have altered these in the approved manner, I think - also sent Astrid an email AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis. AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis. Oncotarget 2015 imex curation Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu Accepted 2017-DEC-01 AT 07:35 GMT AT 07:35 GMT by ORCHARD human thymocytes (CD4+,CD8+) Oncotarget 2015 imex curation I have altered these in the approved manner, I think - also sent Astrid an email AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis. AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis. Oncotarget 2015 imex curation Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu 19-Dec-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag fluorescence tag visualisation by fluorescence tag fluorescence Park J., Schlederer M., Schreiber M., Ice R., Merkel O., Bilban M., Hofbauer S., Kim S., Addison J., Zou J., Ji C., Bunting ST., Wang Z., Shoham M., Huang G., Bago-Horvath Z., Gibson LF., Rojanasakul Y., Remick S., Ivanov A., Pugacheva E., Bunting KD., Moriggl R., Kenner L., Tse W. lukas.kenner@lbicr.lbg.ac.at,william.tse@louisville.edu Accepted 2017-DEC-01 AT 07:35 GMT AT 07:35 GMT by ORCHARD Oncotarget 2015 imex curation I have altered these in the approved manner, I think - also sent Astrid an email tcf7_human Transcription factor 7 TCF7 TCF1 T-cell-specific transcription factor 1 protein protein human Homo sapiens Human MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSSSSSPA 5088C962F2FD0C00 lef1_human Lymphoid enhancer-binding factor 1 LEF1 T cell-specific transcription factor 1-alpha protein protein human Homo sapiens Human MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI DIP protein Q9UJU2 original sequence version: 136 DIP protein Q9UJU2 original sequence version: 73 D480D440698EEFE3 af1q_human Protein AF1q MLLT11 AF1Q protein protein human Homo sapiens Human MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL B37C6F7303C9EBF8 cd44_human_gene CD44_HUMAN_GENE gene gene human Homo sapiens Human mllt11-tcf7-2 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supplementary Table S1 mllt11-tcf7-1 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supplementary Table S1 mllt11-tcf7-3 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Figure 2A Immunoprecipitation (IP) experiments using the newly generated AF1q rabbit monoclonal antibody confirmed an interaction between AF1q and TCF7 (Figure 2A), but not between AF1q and LEF1. mllt11-probe_human_cd44_promoter_region-1 3 6 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line 7 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CTTTTCCTTTGAGGCCTGCCTCAA region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2F, Supp 3B AF1q directly interacted with TCF7 probe_human_cd44_promoter_region-lef1-1 3 5 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line 7 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CTTTTCCTTTGAGGCCTGCCTCAA region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2F probe_human_cd44_promoter_region-lef1-2 3 6 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep 7 unspecified role unspecified role bait bait promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CTTTTCCTTTGAGGCCTGCCTCAA region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line physical association physical association 2Fi