DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure (London, England : 1993) 2015 imex curation Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. DIP original experiment: DIP-265828X Structure (London, England : 1993) 2015 IMEx Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure (London, England : 1993) 2015 imex curation Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. DIP original experiment: DIP-265825X Structure (London, England : 1993) 2015 IMEx Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure (London, England : 1993) 2015 imex curation Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. DIP original experiment: DIP-265827X Structure (London, England : 1993) 2015 IMEx Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure (London, England : 1993) 2015 imex curation Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. DIP original experiment: DIP-265829X Structure (London, England : 1993) 2015 IMEx Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. Structure (London, England : 1993) 2015 imex curation Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Karlsen ML., Thorsen TS., Johner N., Ammendrup-Johnsen I., Erlendsson S., Tian X., Simonsen JB., Høiberg-Nielsen R., Christensen NM., Khelashvili G., Streicher W., Teilum K., Vestergaard B., Weinstein H., Gether U., Arleth L., Madsen KL. DIP original experiment: DIP-265826X Structure (London, England : 1993) 2015 IMEx Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering. pick1_rat PRKCA-binding protein Pick1 Prkcabp Protein kinase C-alpha-binding protein Protein interacting with C kinase 1 protein protein rat Rattus norvegicus (Rat) Rat MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGPNQGGFTDGEDEEEEEEDGAAREVSKDARGATGPTDKGGSWCDS DIP protein Q9EP80 original sequence version: 84 DIP protein Q9EP80 original sequence version: 104 DIP protein Q9EP80 original sequence version: 122 8FDE0D78BB26C006 pick1-1 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pick1-3 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pick1-4 5 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pick1-5 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pick1-6 1 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey proximity proximity close-contact colocalization neighbourhood interaction