DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265818X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265816X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265810X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265807X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265812X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265811X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265808X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265803X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265809X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265813X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265817X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265814X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265804X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265805X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265802X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265815X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. Structure (London, England : 1993) 2015 imex curation Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dimitrova L., Valkov E., Aibara S., Flemming D., McLaughlin SH., Hurt E., Stewart M. DIP original experiment: DIP-265806X Structure (London, England : 1993) 2015 IMEx Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2. g0rzb7_chatd CRM1_C domain-containing protein CTHT_0002400 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MPVSVEELDATVRAFYEGRGEQFKEDPDAWLMVDEILSRATYEQTKCIRNFVVQYILQCSSSEESLRTHRTLLNKLNLVLVSVLKQEWPHNWPTFINEIVSACHSSLSVCENNMIILRLLSEEVFDYSADQMTSTKTRNLKSTMCAEFSMIFQLCQEILNSATQPSLIKATLETLLRFCNWIPLGYIFETPLIDTLRTRFLEVPEFRNVTLQCLTEIGGLQTGGPGQPHTYDEQLIKMFTEVLTTISNIIPLQMDLKATYPNSNSRDQEFIQNLALFLTSFFTMHLPLIENLPNRDFLTHGHFYLIRISQIDDREIFKICLDYWLKLVQELYEEMQSLPLNDMSSMGLGMMSGGGAPNPALLEHYPLRKHKYKEVLSNLRVVMIEKMVRPEEVLIVENDEGEIVREFVKDTDSVQLYKTIRECLVYLTHLDVVDMEQIMTEKLARQVDGSEWSWHNCNVLCWAIGSISMAMNEETEKRFLVTVIKDLLGLTEMKRGKDNKAVVASNIMYIVGQYPRFLKAHWKFLKTVVNKLFEFMHESHEGVQDMACDTFIKIAKQCRRHFVALQPSENEPFIEEIIRNIGKITCDLTPQQVHTFYEACGYMVSAQGNRNQQERLLAELMAIPNAAWDEIIKAATMNPGILHEPDTIKIIGNIMKTNVSACSSIGPYFFPQIGRLYNDMLQMYAATSQLISEAVARDGEIATKMPKVRGLRTIKKEILKLVETFVEKAEDLQAVRSQMIPGLLDSVLVDYNRNVPGARDAEVLKAMTVIITRLQGLMEDQVPAIMENVFECTLDMINKDFAEYPEHRVEFFNLLRAINLYCFPALLKLDNRQFKFVIDSCMWASKHDNRDVETAGLNMCLELINNIAEKTDVQTCNAFFNQFFIRILQDVFFVLTDTDHKAGFKTQSMLLMRLFYFVHPADGSAPKIQGPIYQPDQAQPGTGNREFLANFVGTLLQNAFANLTPLQITTFVKDCFELNTQYDKFRVVLRDFLISLREFAGDNAELYQVEKEQQEREARAADLERRSKVGGLLKPSELEDEEL DIP protein G0RZB7 original sequence version: 19 g0sg92_chatd NTF2 domain-containing protein CTHT_0065500 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MISSGSSHVVSAKSFVEWYYRQINENKPVASGYVNNNATYTKAGHPPADITINGRVVATPEEWDTMLKEQRAQHNTSSSSTLPIGRKPVRYDVDCFDVHVINADYRFAAPQRMIEQHAPTDGVRMMMALTVSGSVYFGASPRSTDDYVIKQHFNDVFILVPNWDVLEKPGARSGRKYLIASHKYRAY DIP protein G0SG92 original sequence version: 8 mlp1_chatd Protein MLP1 homolog MLP1 CTHT_0041070 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAAAEVDLGYLSAQANISQVDLETVVSAPTADLVKSVLAAVLSKIRELEQDKFHLNVELEGAIRGAESRCEQFKATSDKALKEVEELRQKLQSEESARRTLENELQTLKSSGSASLSEIETLRARIASLETSNRETLAIVDSKASANAALSEELQKQHQKILKLNQEINNLNQAVQTAQTAANSAKYREESLKQELELAKKNNDWYDNELKTKAAENLKIRKEKGAQIAQLQREKEDALSTIQSLQKTEQQLRKRLQEAQSKAEEALTKVQQLQESAARAEESFRQELESSKRLVELKDQQAQTHRNRLKEVELRLEKVKDDSAEEIRRVRRELEQAKEDLSQSEQQVQDLQSEVDRLRTLVESHDGVPGSVPQTPRANGSLLARPSSPFGTPASLRGKATQRATETLEELLKVKAQLASEQRRSQKLQEDLDDAVSMLEAKLPEIDELNAESERLRNEVIQMSEIMQQSYEERDAAVKAARKAEAAASQAQAEVKILRAQLRDLSTQIHVLIFNAHAKEKGMDQLTEEEIAQFERLQRGEISEGALEDLSDTHRFITERFTVFKDIYELQQKNEELLKLTRELATKMENEEALAAQRQAAQEHEEVQQLRATVAALQDEVRSITIRMKSHMTERDMFRRMLQQRATPAEIQKVLGTQADGEQREVLPSVEQPHANEAQLAAALRELQAQFDAYRNDQVTDRNAMREQIDKLSGEKGSLQSEVTKLSSQLTLATERYNMLESNFKALQSENQELQKRNQSLSEAAAKQDIRTQQVAEDLVEARGLVESLRSENANLKAEKALWRTIQERLTQDNESLAQEKTRLNGLLASQQSLLNERELSEAETKRRLQAQIDSLEAELSTTKRKLSEEIEESKKVQLRKEFDAQQFQKRIDELTSMISQVKEENIQVKTTRDHLQARVSELEIEVRNAQERAERLRPLPTPRAPAAAEQPSEEAQARIEELEGEVQELKNNLDLLTVQLEHAKQQAEQFKQLSKDMEEELSSLNESHEQYRQEMDAALASKANTINELQQRVEALTAELSNTNNELNMLRDSQSDVARKFEEKERMLNAEIARLKDEEERYKEAARFHQQDLRAQAEIATKAQQDYEQELVKHAEAAKLLQQLRAEHNELKTQAAAWRAEADSAKISLAQSEQSWEERRQRLEQEIAEIKARRDDMAAQNKLLHQQLDAVTAQITALQQKRTQGDVSGEAAAPAIADMATEGLRELNSYLRREKEILEVQYDIKVQEAKRLQQQLEYTQSQLDETRLKLEQERASQADSTRTSLTHKELMEKLNELNLIRESNVTLRNENQRAQALLEQKAARITELEAKIQPLEARIAELELDKGFKEEEIRQLQEARDGLQKRIETILSKYGQADPQEVEQLKAMIAALEGERDVLKQSEQALQQKVKEAENALETKTNEWKATREKLAEDFKARFRNMKTQRDEATNEKNTLQATLDGVKEQLAALEKELETTKQQLATATEKNTSLQQQLAASSTEQPAAAPVSAAPSDQINELTQQLQAVKQQLESVSAQKAAAEAQVEQLKQELAAAIAERDRALAATSGGDVATAETSVSAQPSAGLSDEERKALEEKIAAAEAKAAEFEKRAKELEEQADNIVKQRSDKMKTALNKKLQESKEAMEKQIQEEKAKLQAEFDLKLQQELAIIKAEQQTAGPQNGVPATPVKTEANAAPGTPVPDITNMTDAQIREAVAKNPTISAIVKSNVKRMVAAETKKIKEEIEAALKAEYEQKITNAKEQATALTEKKSALRINMLDRQHKTAQAKLAIVETAAKETPQKPVVEVWNIAKDAKPPAPAQAPAPAPASAAPSPAPTPAQPVAPATAAPAAPAQAPSAAPPKEETKQEAKTTTAAPPSAIPKPAVNPFTAPLNPFGAPAPTSNIPAPPQAGQQPQQTQPQQPQQPQQQQQQQKGQQQQQQQQQQQQGQQQQQQGQQQAGGQNQPQRMGIPVPAGRGGPGGARTARGLYQAGPRGARGGRGGGFVGAGRGAGGAAGGLNPNAGEFTPGGATATAAAAAAAGGAGGSAGAGNAGNKRQRDGEGGQPQGERGGKRARGGGGGGGGNQ DIP protein G0SA56 original sequence version: 10 g0s666_chatd CTHT_0034350 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MNLVIQFLSSIRQFVIAQNSDELRNWLLVETDAADIYYEMGKQIRSGCPPGRPILEDLVEKCLPMEDDVQEGRGSPWPGFNSFIKDYLEYWRDMNPDDILGLHSRLSELLVSCANALANPTYGNILLPTAMSLSESLCKLVMNLNRQPHLLAQIQGDTSGDETGERKSIVEAAADIIQKIFTSCLTDRSSSRWSQPKGKKVAVYIFANLTLKLLFACDKSRLAVQMFTNLSTSGPALSLYPASQRVTFLYYLGRFNFDHGHYLRAHMCFEEAYLQCPPRFQKHRRQILLWWIPTNLLLGRFPSQALLQRPEAAGFAQIFLPICHAVRTGNFVAFHQTLAQNRDWLWDRGFYLTLLYRLKPLIWRSLTRKTFMLTWQGSAAGDPNTTTTTTGNKAASLALEDVVTVACYVQKLLEGYVPVRKPKLAASVSPAFMQTGGNPTSTFALDGSREPTLVPPPGGPRQLMPSEGLIFGNKKPDLESIEAVVSGLVYAGLLNGFIARHQKRFAVEGTKKKGGNAVAAGWPNPYESILERFREAHQEALDACDEGSGEPPGELDDVPGWVRSPT DIP protein G0S666 original sequence version: 8 g0s7x9_chatd CTHT_0037380 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MASSQTAAKKDDKSAADTKQEQTVVEQKPAVLEEDDEFEDFPVDDWPAEETEAANGGGATQHLWEESWDDDDTTDDFSTQLKEELKKVEAARKR DIP protein G0S7X9 original sequence version: 8 nu145_chatd Nucleoporin NUP145 NUP145 Nuclear pore protein NUP145 CTHT_0042590 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MSFGFGSGGFGQNNNSSTFGGFGSTPTTNTGFGSTGTTAFGSTSNTTGGGLFGGGGGGFGSGNTFGSGFGSKPAFGTPATTSSTSLFGSTTTTAGGTGFGSGGFGSTNTSSPFGGGGTSLFGNKTTTGFGSGTSTFGSNTGGGLFGGGSTTTGFGATNNPGIGTNVGDPPGTAVVPFSPTVEKEVNNPSQSNSYQNILFMDAYKKWSAEELRLADYNQGRKTAAPGGTGAFGSSGFGGFGTTSNTGGFGSNTGGGLFGNTQQNTGGFGTTNTTGSAFGSGGGLFGNKPATGGLFGTSSSQPAQSGGLFGSGTASTFGSSNTGTTSTFGSNNNTGGGLFGSNNTSSKPAFSFGTSNTSTPGFGTATTGSGFGTGTTTNTGGGLFGNTAQNTNTGGGLFGNQQQSGSAFGSGTGFGQQNQSTGTSLFGNTQQKPGGLFGSTTTNTSGGLFGSTNTGTSTFGQTPATQNTGGGLFGSKPAGTGGLFGSTATNQPASTGGLFGNLNTNAQTQQPATGGLFGNLGQNNQAKPSLFGTSTTTGGGLFGNTNAQQQTGSLFGTSTAQQQPQTGLGASLFGSSQQQQQQPQTFSTSITDISAYGATTLFSGLPDDKIQNPGPLATPLSGKAKVKSRSILPMYKLSPANASRLVTTPQKRAYGFSFSAYGSPTSPSSSASSTPGAFGQSILSSSINRGLNKSISASNLRRSLNVEDSILQPGAFSANSSMRLLGGPGSHKKLVINKDMRTDLFSPPNKDKQPQEDGTAARKTVTKRVSFDTSNVETPEKTIESSIPATDDSGYLKPDARSTANGTNGANGAKSSPVAAASPPEMEQVKGKELAVVHEEESPAPAQTDKPRGSQIEPGAYWMSPTADDIRAMNRMQRQRVVGFTVGRENVGSVQFKVPVDLSNINLDDLFGTIVILEPRSATVYPNAAKKPPMGKGLNVPALISLEHSWPRGGPTIKGRRLERHIERLKSIPDTTFESYDPETGVWAFSVEHFTTYGLGDDDDYDDDDYETEPESAVKSTPRPVTSPSISKSSTSPIDPDDTFEFRRSRRALPGAFDDAALSDTDEVANHAQRQGTLSPEPQDADTPLPSREWPEDESMADGLDEYQLEAYEEASQQGSVDEQEDFLPSRFAADNDAPQVPAGIMRARMRAVKKLNAPTKIEVAGGDDWTQILQASVKAPRTMDRATLRALNESGAVWEMKDRGSPPPQATATVSDGMGFATSIDLMKSLFEQAKAPTQPALTTSGKGFVKWPYEQRSKTDTEENLAVPRTNWGPNELLISTQHNEPNLLPVDAADDSATSPSTLARLQQYINLVSSKKQLQRVAGPEFRELAQGDSVWELAALLFDDNGEGVSQFWQQLVSEATDRALSFTAGLEEKAIICLAGNRVDEACRHLLAAGNFRLATLVSTIGKVDNKDIRAQLKDWRESNVLAEFSEPIRAIYELLAGNASVCAGVKNVPIENRVNSFTISQRFGLDWMRSFGLRLWYTSGVIPDVAAAVRSFQEDIEQDREPEPDSALWTLLKAFASREYDWSDTRLGWLLTKAIYTTGKVSFGEDALQKLDKASVTFASALTAASHWVPATFVLLQLSDPASREAAVRDHLGRHAHRIGSPRNLMSPFFTLQKFGVPEAWIWEAKALDYRSRQDSQQEFLALIWAQNYAEANRTFVTRVGPDLVIERNLPRLFAFAQLLFKVKKHLPNWERSAAVYLLYPMAVMQNQGSGKLDRFDNQLIDGLVALHSQTHGDIRQEAAIADMAEELIKCKGAAAASDPRLLQLLPQDVRGKYLRAQVLEAF DIP protein G0SAK3 original sequence version: 13 DIP protein G0SAK3 original sequence version: 14 g0sar7_chatd CTHT_0043240 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAATRQIQYTIPPREDYNKLSDEQKTRISEAFELFDSNKDGLLSYEEFRFVLRALGFDLPKQQTYDMLVRHGQRPANWPHDQECPPVYRQFNLATAQALAGTLIRQRDPRDELRRAFRLFDVDGKGMITEDDLRKVCQQVGNNIPDADIQAMIEEFDSNGKGGVDEDEFLRLMMSKK DIP protein G0SAR7 original sequence version: 18 g0sgz5_chatd Importin N-terminal domain-containing protein CTHT_0068110 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MDWQPNPESLGTLAACLKDSLSGFNKAVQKQAELMLSQAKANPDINNYLAFIFSSTESPPVLALSPNDWHLVRSAAAIMLKNNIKSNYKQIPETSIALIKLAVPIGIQDKNSQIRNYAGNIATEMIRRGGLYSWPELLEELLRLLSNETGQVPPEAQEGAMAAMAKICEDNTKLLEREHAGQRPLNVLLPRLIQATKNPLPKVRALALEAINVFTPRKSQAMLHNIDDLLQHLFFLAQDPVADVRRQVCRAFVHLVDTRPDKLLPHLSGLVDYIISQQKSDDEDLACEAAEFWLSVGEHDNLWRSLEPYIQKIIPVLLDCMVYSPEDIAILGGASDDEDEEDREEDIRPQFAKKSLKRGGAGDANGDSANAYEKLTSMDNDLEEGEIDELDEEGDENPDEKWTLRKCSAAALDVFATDFGGPVFTCILPYLQKNLKHEDWPYREAAVLALGAVAEGCMDVVTPHLPELIPYLISLLEDPEPVVRQITCWTLGRYSSWAANLRDPAQQQTYFVPLLDGILRKMVDKNKKVQEAGASAMANLEEKAGKHLEPFCGPIIQQYVLCFSKYKDKNRWILYDCVQTLAEHVGPVLARPELRNQLMPALIDRWQKVSDQSREMFPLLECLSFVAIALGDAFTPYAEPIFARCVNIIHQNLEQAMAATNNPDLDPPEKDFLVTSLDLLSSIIQALDNAKAVRLVQSSQLPFFELLSFCMEDPADEVQQSAYALLGDCAKFVFEQLQPYLPSILPILLKRLDLDNILDEEVDGHFSVVNNACWSAGEIALQYKKEMAPYAMELLQRCVEIISNPVVPLGVLENAAILIGRLGIDNYEILAPHLSKFAEDFLRVMEDTDPSEEKATAFKGFSIVVAANPQAMEKDLLRFFTSIARYHDLKLQNPIKHELHEAFQNVLNIYRQLIPQFNQFLAQLQPQDQQALKATYAL DIP protein G0SGZ5 original sequence version: 19 g0s6y1_chatd CTHT_0027270 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MASQHSPTPVKVPAAAANYTPATLDQDLRSQINSLLIKEGHVAKIQEHLLHHLHAHPSNWPTVVQNHALSLLRSGEVTSFPALLRRVVEDVRQDTALAPSSTTANGNGESTTTNGATNGKGATTNGNKGGVADLKPSLAVPQSVVEEALKVTRECLDQLCEIEEPLAA DIP protein G0S6Y1 original sequence version: 7 g0sgl4_chatd CTHT_0066750 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MMAPANNPFGAPPAQVNNPFASPAPSNQGSSVFGAPAQSTFGAPSSNNPFGASSAKPSGAPAANPFGAPIKNPFGASAQNAQNKPFGAPTAGNGSSLAAANPFGAASGQTSAFGSTPAGSAPQSKGSSRQPSPAGRQNQSGRQQANLVGAPQGPSGKKRTPSPFDTRQRTQAPSKRAQASEESDSDAMSGRKSKGKGFGGLKSQPPAANKATNNANTTGFAGRTNRNSQEATPFADLKSTLKKIAGQETEKFTKKAKPGEKNKKPERQVRFQPTSQVNGNKNGPMREPTERTKELSTFAYEYANDLLGHLKKENINPPQWPAEPGNPNKRGAIESLKEAYKKYRARVYASLRKADKIDDPEKRRKLEDALPFKGICEDMCPEFEQVSRIAEYDVMTEEKSVGPDGHTLWPDPAKMVKKFGRSAAGQDAPLPMDVRTVDALRRTTDYLFNDLLQSENNLPAMHNFLWDRTRAVRKDFTFHSQKTAEEMKDMVYCFEAIARFHAIALHLLSRKGFANEDFDQKQEIEQLGRTILSLMEAYDVCRDMKVPCENEPEFRAYYLLLNAGDPAIAKRIPTWGKEYWFESEEVQTALSLIHTMEDVREPKGPIKPRKGTTLSDTSFTNYFAIVEDPRVSYTMACIAEIHFTTVRQGILRNLVRCYARHRDAPRTITASDLNAMLRFDTPEEAVEFAELHEFEFTTWVPDGKPEVKEPYLLLNQKKKIVPSPRVRQSFSAQIVERKRQGQPLPFVIYNTVYEEMSEKPAGSIDDDGSPDSLFVSQKSPELTRSVFGAPSTTTPSFFNAPSAASTTAAPSTGTVASSIFSFPTTSSTPQLRATSSTGTTSQLSAFGSAQSSQPASSTTTTSVFGGFGKPAEPATTESPFSSLSQPTTTTMTTTPAAAPKPNFPAEPPKQPEQAATSSTTTSPKTADKNPFSFLKNNDVLAKQPSTSFVFPSTSTLSGSAATPTPSISTTTTFDATTKPTASTQTYQFGAAPAGGSSLFPTATPTKSADKQPVTSASIPSITVTPPPTSTPATSAESKPTLPAALPAIFGQQPLPPASTSQPSLFASIKPAASPTKPQEPPPPPKPKRDLMADFTKWFVTGDGGIMEEFTEETLRHLLWDVWQRHQREEAERKRKAEEEESWRLAREHLTHRLQVKYFYRWREKARALATKRLLREGKEKMRLYREQQRLLQKQRLEEQRKAEEEARRKAKREIMEDAQHFSFLASQIRARRASSMAYSADQTEEQLVASGIFSGLNEDPHAIARSVVREARAAEMNGSYAVTDAASVTPSRSTFRYPESDLELEPAPSHHGSDTASSIGGRREGWKTRSLREKLGIGVPKFDGRRSLSGTFSADGLNSFRQSLRSSVGSSVNGRATNFSVAAAARKRNSEELSGDEIDTMSLGGAARKRRALFGSSVASISSAIGSLSKSRHWELRARGFVPMPDGAWLPEAVAKLRREQAERQRKEEDERKRREEQLRQLQEQQQDDDEPEFPFQREESPTKLSTGELRARLAKLKEYKEQRSKGLRNSIDLGTHSPLHPTDPFQQQEVTLHQKRKRDANTAAFDEERASRCSPSDKEADAKARGYSPISTSRKRLNLNDTPTRSWSHHHNSSSTTPTFVRPPLPPQYQQHQPESSPPPPLAVRPFTTVEAAAAARAASPSTTPTGVPTVSVLGREETAAMVEDTWRMLRELHECMDQLEEKDREERPVMGMKG DIP protein G0SGL4 original sequence version: 8 g0set4_chatd CTHT_0059630 protein protein chatd Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) MAPPTGPRRGGSAQKTALRPTRGGGISKHRPAPKTDIDGDIAMGGPPADTSKRGSGSSGRGARAGRGGRATSRMAQNIRNYATELAVGSNGAKTQPNKTVIKILGLKNSKAASNPDGGLRSLLDFLERKSKEKITLGRGIIDGDYVWLKVNKDDAQHLLRLNGFTYAGATLTIEETNEPMPALSSQSKLSQAAQETKQKLTSCLARRYNAEQKLLDLSALGTDETLSSLGSFNNQSLAEKSFKALMHLVSNEYKDPEQKNEAIQAVSLARNDILDVGQVYSLAVTLPRLRRLDLSGNNLENLSKISKWQQEFRFLEELHLTGNPVTTLPNYATEIKKWFPSLQILDGQQIRTPQEAAESLKSSFPTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPRHPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQPAPQVGTVPPPAVAAPMPGAVPIPTATPAVAPVPPVMGDEPDDATKAQLIAEVSRRTGMNVEYSQMCLTGAANWNLELALQSFEQQKANVPPEAFISQPQV DIP protein G0SET4 original sequence version: 13 g0s666_chatd-g0s7x9_chatd-1 15 27 unspecified role unspecified role unspecified role unspecified role Region 415-755 Region 415-755 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association g0s666_chatd-g0s6y1_chatd-1 9 26 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role Region 1-1191 Region 1-1191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association g0sgl4_chatd-g0set4_chatd-1 6 27 unspecified role unspecified role bait bait Region 1-104 Region 1-104 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-60 Region 1-60 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 60-120 Region 60-120 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey Region 365-564 Region 365-564 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association g0set4_chatd-g0sg92_chatd-1 17 27 unspecified role unspecified role unspecified role unspecified role Region 1-20 Region 1-20 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role Region 365-564 Region 365-564 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association nup145-g0rzb7_chatd-1 16 18 unspecified role unspecified role prey prey ecolx Escherichia coli 23 unspecified role unspecified role bait bait Region 213-567 Region 213-567 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association g0sgl4_chatd-g0set4_chatd-2 5 27 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-784 Region 1-784 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey Region 365-564 Region 365-564 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association g0s6y1_chatd-g0sar7_chatd-1 8 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role Region 1085-1170 Region 1085-1170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association nup145-g0sgz5_chatd-1 12 25 unspecified role unspecified role prey prey ecolx Escherichia coli 23 unspecified role unspecified role bait bait Region 213-567 Region 213-567 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association g0s666_chatd-g0s7x9_chatd-2 1 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role Region 1-784 Region 1-784 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association g0sgl4_chatd-g0s666_chatd-1 3 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role bait bait Region 1-1191 Region 1-1191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role prey prey ecolx Escherichia coli 21 unspecified role unspecified role prey prey ecolx Escherichia coli association association g0sgl4_chatd-g0s6y1_chatd-1 13 26 unspecified role unspecified role prey prey ecolx Escherichia coli 24 unspecified role unspecified role prey prey ecolx Escherichia coli 27 unspecified role unspecified role bait bait Region 1085-1170 Region 1085-1170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association g0set4_chatd-g0sg92_chatd-2 4 27 unspecified role unspecified role unspecified role unspecified role Region 20-40 Region 20-40 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role Region 365-564 Region 365-564 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association g0set4_chatd-g0sg92_chatd-3 11 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 28 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction g0s666_chatd-g0s6y1_chatd-2 7 26 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role Region 1-1191 Region 1-1191 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association g0s6y1_chatd-g0sar7_chatd-2 14 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 24 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role Region 1085-1170 Region 1085-1170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mlp1-g0set4_chatd-1 2 20 unspecified role unspecified role bait bait Region 1797-1916 Region 1797-1916 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli association association nup145-g0set4_chatd-1 10 23 unspecified role unspecified role bait bait Region 213-567 Region 213-567 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role prey prey ecolx Escherichia coli association association