DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265888X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265885X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265886X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265887X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265881X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265880X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265883X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265882X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. Nature 2015 imex curation Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mochida K., Oikawa Y., Kimura Y., Kirisako H., Hirano H., Ohsumi Y., Nakatogawa H. DIP original experiment: DIP-265884X Nature 2015 IMEx Receptor-mediated selective autophagy degrades the endoplasmic reticulum and the nucleus. atg11_yeast Autophagy-related protein 11 Cytoplasm to vacuole targeting protein 9 ATG11 CVT9 YPR049C YP9499.07c protein protein yeast Saccharomyces cerevisiae Baker's yeast MADADEYSTAPTQQEITPLQTTATIINAISGECITTNVDFFVSLDKFKQFIARKWKIPPDQLLILLPYGNKLKPSMFKELLINRSFTLNDFYVYDRRLFSLVSKPTPTNLLTSKDSNPMNSPNSNDLTETLEYLIKNSHISQYQGSDTIMIKPMPSPLEDADVDLSRLNYHSVTSLLTTNLGWLSALEIDVHYFKSLIPDIIAHIKRIFDGLTVCSQYLKLYCFDVESLYNSNVQFLNQLVDNGMTSKWEKCFNDTLSKLTALEGDSLQKFINIESLLENEKSVKILNHSINGKLNKIKREIDENASFRDIITVNIDRLRQMFTPNESKFELEDQMAESFEVLVSEMRTRSRNVLDKEEEEFNSQEFLKSMNVMLEKDKKESVKTLFTISQALYSQIGELIDLKKSLQKHAVAILGNIAFTQMEILGIKRLLLNECNKDLELYKKYEVEFAQVEDLPLIYGLYLIEKYRRLSWFQQILSFISNFNQDLELFKQNELRTRNKWVKNFGSIATVFCEDLLSSSDFKRLNEYHSHTSPPNEDEEDENENSIANYRQDLVKVSQAIDNYMTQIKETDVSEPIIDLLSKTLFETKRFHIIYSNFKNNNNNSSNGNSISPEGSIALKSDDVVKGYKTRIKKLESLLHEFQYSDIGHWPQGVLNTHLKPFRGSATSINKKKFLGASVLLEPANISEVNIDSVSQANNHQIQELESNVDDLLHQLQLLKEENNRKSMQISEMGKKISDLEVEKTAYRETLTNLNQELARLTNEEQSHRTEIFTLNASFKKQLNDIISQDNEKIEKLTGDYDDVSKSRERLQMDLDESNKKHEQEVNLLKADIERLGKQIVTSEKSYAETNSSSMEKGEKFETIPLAEDPGRENQISAYTQTLQDRIFDIISTNIFILENIGLLLTFDNNNNIQIRRVKGLKKGTAQSNILDESTQMLDAHDNSLIKSPVFQKLKDEYELIKSVANGSEKDTQQSIFLGNITQLYDNKLYEVAVIRRFKDIETLAKKLTKENKIKRTLLERFQREKVTLRNFQIGDLALFLPTRENVNSVGSMSSSTSSLSSSFSSVDLSTPPPLDAMSIQSSPSVIHSNVINQASISGRDKNKLMRPWAAFTAFEESTRYFLKDEKGLTKGKEWFVGRIVTLEHFVADSPSNNPFRLPKGSVWFQVTAVVVSYQGV A904B92E9AE79449 A904B92E9AE79449 atg39_yeast Autophagy-related protein 39 ATG39 YLR312C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEDDHWNLVRLRRLRKGREGEEQSSKSEISLDSLHESSFAGEDDEDFDADVLSNTSSEESAQMNRIYDFRTSNEFSNAGVNIDQTGVPTISESFDTLSGSNVGGTVLPSMEGSKLKDSTIRNSSTLSDHIIDKSEGKSAKLKMWHVIMLSSLLSMTFSYLALEYSLTGDVLAGFKSQQSLRNNERKLLYGNIDFVDKKSYDSSSDSLSQWAPSGKYYVDFDNHIAYPLKDDDLMGWRRYKTDLVILWYTTKARMKDGWHKRINKINGGRIKLHLFLKNSFKSAQESLRVLHKEQKRRWKRLFVLLHNKYRQFSPHIKRYFDHSCQKAKQCWSGSRLQLRKLRFKSMKPFRVFQFKVRKDTNWFVKQLKRFGLKLQHSRMYKAMSECRKKNYFKCKH 0592D785516D9F90 0592D785516D9F90 atg40_yeast Autophagy-related protein 40 ATG40 O3536 YOR152C protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNLILWPLFLLTSVAIPLQLTLEVVYLTSSVDFSKASAAKTATSLGQSPVVITIYKSLLKYWSLYEFIHFIYLYTPIDAFLNFLPFTSLLMSFGSICLTRELVYDFIAFMESQNKLTGFLNKITEPNFNSYLLFSSIYNIWFADDTNDKFLFGKLTQILISVTKRYEFPRTFYLAKVSDFLQNLILTRLRPFVTEQPQGDKNRYQNGDRESTKNGAAYQKSSQQSSSFEQNFTSTEFPNDYDFMEDILDETTELD FD4951C817E2AD0F FD4951C817E2AD0F atg8_yeast Autophagy-related protein 8 ATG8 APG8 AUT7 YBL078C YBL0732 CVT5 Autophagy-related ubiquitin-like modifier ATG8 Cytoplasm to vacuole targeting protein 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR 1246CEFF5A038819 1246CEFF5A038819 atg8-atg39-1 6 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q06159:p.[Trp8Ala;Val11Ala] W8A/V11A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'W8A/V11A'. Wed May 02 18:02:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp8ala,val11ala' Tue Jun 30 15:39:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp8Ala;Val11Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg8-atg39-2 8 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait P38182:p.[Pro52Ala;Arg67Ala] P52A/R67A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P52A/R67A'. Wed May 02 18:20:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro52ala,arg67ala' Tue Jun 30 19:55:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro52Ala;Arg67Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg8-atg40-1 9 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait P38182:p.[Pro52Ala;Arg67Ala] P52A/R67A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P52A/R67A'. Wed May 02 14:47:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro52ala,arg67ala' Tue Jun 30 17:11:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro52Ala;Arg67Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg11-atg40-1 2 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg8-atg40-2 4 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P38182:p.[Pro52Ala;Arg67Ala] P52A/R67A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P52A/R67A'. Wed May 02 16:37:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro52ala,arg67ala' Tue Jun 30 18:47:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro52Ala;Arg67Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg8-atg40-3 5 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q99325:p.[Tyr242Ala;Met245Ala] Y242A/M245A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain M A certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y242A/M245A'. Wed May 02 14:50:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr242ala,met245ala' Tue Jun 30 18:31:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr242Ala;Met245Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg11-atg39-1 7 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg39-atg11-1 1 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role bait bait Q06159:p.[Asp52Ala;Val53Ala;Leu54Ala;Ser55Ala;Asn56Ala;Thr57Ala;Ser58Ala;Ser59Ala] D52A/V53A/L54A/S55A/N56A/T57A/S58A/S59A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D52A/V53A/L54A/S55A/N56A/T57A/S58A/S59A'. Wed May 02 15:41:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp52ala,val53ala,leu54ala,ser55ala,asn56ala,thr57ala,ser58ala,ser59ala' Tue Jun 30 17:27:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp52Ala;Val53Ala;Leu54Ala;Ser55Ala;Asn56Ala;Thr57Ala;Ser58Ala;Ser59Ala]' GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association atg8-atg39-3 3 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P38182:p.[Pro52Ala;Arg67Ala] P52A/R67A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P52A/R67A'. Wed May 02 17:35:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro52ala,arg67ala' Tue Jun 30 17:36:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro52Ala;Arg67Ala]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association