DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266072X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266068X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266067X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266070X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266069X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266071X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266073X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. Nature structural & molecular biology 2015 imex curation Suzuki H., Kaizuka T., Mizushima N., Noda NN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Suzuki H., Kaizuka T., Mizushima N., Noda NN. DIP original experiment: DIP-266066X Nature structural & molecular biology 2015 IMEx Structure of the Atg101-Atg13 complex reveals essential roles of Atg101 in autophagy initiation. atga1_human Autophagy-related protein 101 ATG101 C12orf44 PP894 protein protein human Homo sapiens Human MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL DIP protein Q9BSB4 original sequence version: 86 DIP protein Q9BSB4 original sequence version: 99 DIP protein Q9BSB4 original sequence version: 100 DIP protein Q9BSB4 original sequence version: 95 69A881EAF9A07659 atg13_mouse Autophagy-related protein 13 Atg13 D2Ertd391e Kiaa0652 protein protein mouse Mus musculus Mouse METELSSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALSGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLNGLGEGFQTVRVGTVGTPVGTLTLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAEDAGVAYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAVLGLGSADLAYPVVFTAGLNTTHAHQLMVPGKEGGVTLAPSHPTHGAQADPERLVMHMPSDGTHCAATPSSSEDTETVSNSSEGRASPHDILETIFVRKVGAFVNKPINQVTVTSLDIPFAMFAPKNLELEDADPMVNPPESPETTSPLHGSLHSDGSSGGSGGSTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDFGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ DIP protein Q91YI1 original sequence version: 74 DIP protein Q91YI1 original sequence version: 99 mint homomint 04B4E49BB19449F2 mug66_schpo Meiotically up-regulated gene 66 protein mug66 Autophagy-related protein 101 atg101 SPAC25H1.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTNTVTIELKIGYKYAAEVVKAVLGVILFHRQFSTVPARTIDVLDITVPTLVGAELNEQLATKAAEFIDTIRNEAGANGQMILLLYERSPKKSWFGKGNTIPWEQWILHTTILEEGDSYQESSLSLEAAVEQIVQAVNLRSLSYLPPVAMDSGNYPYEIVTPTSTEGWGSLLKRMIIENVSGGD 9F08647CBF182A6B atg13_schpo Autophagy protein 13 atg13 Meiotically up-regulated gene 78 protein mug78 SPAC4F10.07c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPRLNTQLPRMYSAPPGHSKAVSTELNKDLSSVGGRSAKLGQVIHHCFYKTGLIILESRLNVFGTSRPRESSKNNKWFNLEIVETELYAEQFKIWKNIELSPSRKIPPMVLHTYLDISDLSKNQTLSVSDGTHSHAINFNNMSTMKIVLERWIVNLDGEALSTPLELAVLYKKLVVLFRSLYTYTHLMPLWKLKSKIHKLRAHGTSLKVGCALSTDDVLSNDFLPISAPISSSLGSSIATFSFSPVGTPAGDFRISVQYRKNCHFEVHDSDALLSNQLLSADKHQLAASNNSQDFEDGKQYDQPPPSFATRLAKQSDPNSLLQSEIQHLASIESITAQAAPLVTIHPFKSPSLSASPGSNFDNMSISPKVAVNRYIHRGPSATSLNKFSMISDAASKSRAKLPPLTSGSLKLNTLDISNTPNLRRFSSSFGPRERKESFSSRNRLPLVNHPIRSIFKHNVSENPITDHSEHAVYDSEFASKDDLSGFIQLLDSHAHHLNASEGSKSSGSFPGKVQTLTSGISPVAHPHNSLGSSNEIFDIDTYNHSIDNSGSRFTEAVKHNLGNSSHSIMRHHTLGTLRSRPSFSEKSTFPAPLTSISQASTFQGDNRSPSTVIPHTQTEVPSANDTSKQLASLHDMRKSQSPICARSATSAGLPRFEYHTSLSKSLEHSSTPASLQATKTPSPSFVLEPGIPQEYKKHFDNLSEERRQCLTPSTPTYEYYNEHNPNYDDDLLFTMTDMTLEPHDVSAIRLGSPKSDD A6C9E32818607C84 spatg101-spatg13-1 2 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 32-269 Region 32-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction spatg101-spatg13-2 8 11 unspecified role unspecified role unspecified role unspecified role O13978:p.[Phe29Arg;His30Arg] F29R/H30R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain F R This feature has been corrected as a result of our quality control procedures. The original label was 'F29R/H30R'. Wed May 02 14:44:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe29arg,his30arg' Tue Jun 30 18:43:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe29Arg;His30Arg]' ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 32-269 Region 32-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction spatg101-spatg13-3 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 32-269 Region 32-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O36019:p.[Val176Ala;Arg179Ala] V176A/R179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V176A/R179A'. Wed May 02 20:27:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val176ala,arg179ala' Tue Jun 30 20:19:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val176Ala;Arg179Ala]' O36019:p.[Thr183Arg;Leu187Arg] T183R/L187R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain T R This feature has been corrected as a result of our quality control procedures. The original label was 'T183R/L187R'. Wed May 02 16:56:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183arg,leu187arg' Tue Jun 30 20:14:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr183Arg;Leu187Arg]' ecolx Escherichia coli direct interaction direct interaction spatg101-spatg13-4 5 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O13978:p.Phe29Arg F29R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F R This feature has been corrected as a result of our quality control procedures. The original label was 'F29R'. Wed May 02 16:28:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe29arg' Tue Jun 30 17:09:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe29Arg' O13978:p.[Phe29Arg;His30Arg] F29R/H30R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain F R This feature has been corrected as a result of our quality control procedures. The original label was 'F29R/H30R'. Wed May 02 15:33:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe29arg,his30arg' Tue Jun 30 15:36:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe29Arg;His30Arg]' ecolx Escherichia coli 12 unspecified role unspecified role prey prey Region 32-269 Region 32-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg101-atg13-5 1 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9BSB4:p.Thr63Arg T63R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T R This feature has been corrected as a result of our quality control procedures. The original label was 'T63R'. Wed May 02 19:38:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr63arg' Tue Jun 30 16:33:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr63Arg' Q9BSB4:p.[Leu30Arg;His31Arg] L30R/H31R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L30R/H31R'. Wed May 02 20:27:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu30arg,his31arg' Tue Jun 30 19:47:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu30Arg;His31Arg]' mouse Mus musculus Mouse physical association physical association spatg101-spatg13-5 6 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Region 32-269 Region 32-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O36019:p.[Val176Ala;Arg179Ala] V176A/R179A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V176A/R179A'. Wed May 02 15:36:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val176ala,arg179ala' Tue Jun 30 15:59:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val176Ala;Arg179Ala]' O36019:p.[Thr183Arg;Leu187Arg] T183R/L187R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain T R This feature has been corrected as a result of our quality control procedures. The original label was 'T183R/L187R'. Wed May 02 16:04:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr183arg,leu187arg' Tue Jun 30 17:27:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr183Arg;Leu187Arg]' ecolx Escherichia coli direct interaction direct interaction spatg101-spatg13-6 3 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 32-269 Region 32-269 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction atg101-atg13-6 7 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9BSB4:p.[Leu30Arg;His31Arg] L30R/H31R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H R certain certain sequence position certain certain certain sequence position certain L R This feature has been corrected as a result of our quality control procedures. The original label was 'L30R/H31R'. Wed May 02 20:26:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu30arg,his31arg' Tue Jun 30 16:00:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu30Arg;His31Arg]' mouse Mus musculus Mouse physical association physical association