DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266268X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266273X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266269X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266274X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266275X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266270X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266272X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. Science (New York, N.Y.) 2015 imex curation Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Tchasovnikarova IA., Timms RT., Matheson NJ., Wals K., Antrobus R., Göttgens B., Dougan G., Dawson MA., Lehner PJ. DIP original experiment: DIP-266271X Science (New York, N.Y.) 2015 IMEx GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells. h3k9-2 Histone H3 N-terminal Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQLA pphln_human Periphilin-1 Gastric cancer antigen Ga50 HSPC206 HSPC232 PPHLN1 CDC7 expression repressor protein protein human Homo sapiens Human MWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDRPGEGSYNRYYSHVDYRDYDEGRSFSHDRRSGPPHRGDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYARERSPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYKRQNEGNPERDKERPVQSLKTSRDTSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIESAGQTWQQVPPVRNTEMDHDGTPENEGEETAQSAPQPPQAPQPLQPRKKRVRRTTQLRRTTGAPDITWGMLKKTTQEAERILLRTQTPFTPENLFLAMLSVVHCNSRKDVKPENKQ DIP protein Q8NEY8 original sequence version: 113 FE5AAC9A6875A455 cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS DIP protein P45973 original sequence version: 138 DIP protein P45973 original sequence version: 116 DIP protein P45973 original sequence version: 115 DIP protein P45973 original sequence version: 124 DIP protein P45973 original sequence version: 154 DIP protein P45973 original sequence version: 132 DIP protein P45973 original sequence version: 155 16FFC476367093B1 tasor_human Protein TASOR TASOR C3orf63 CTCL tumor antigen se89-1 FAM208A KIAA1105 Retinoblastoma-associated protein RAP140 Transgene activation suppressor protein protein protein human Homo sapiens Human MATAVETEACQPTDASWESGGGGDDEMKQALPELESSQQNGGGGGLNIAEPSGGAGREENAGAEAAQSLSHEQPQDSSEAGAAALPRGPEEPERPVRRSFQIPRKSREKKALFQPLTPGSREFEDVVNILHSSYLEPTSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMVDRYQVQTICEKGLHVGQSKITILGSPSMGVYLSRYADLLQANPLDTGAMGDVVIFKIMKGKIKSIYDPMGVKSLESMLNKSALDPTPKHECHVSKNANRITSLLAYRAYELTQYYFYEYGFDELRRRPRHVCPYAVVSFTYKDDIQTPKFVPSSRSNSFNTDRNIDKYNYTLWKGQLLNKGKLLCYISLRSATRAFLPIKLPEKLDVETVMSIDHLKQKIPPALFYKETYLGPNEVLKNGMYCSLYEVVEKTRIGSNMESLLQKLDREKLVLVKPLGDRGYLFLLSPYQMVPPYEYQTAKSRVLHALFLFQEPRSIVTSQKGSTNAAPQERHESMPDVLKIAQFLQFSLIQCRKEFKNISAINFHSVVEKYVSEFFKRGFGSGKREFIMFPYDSRLDDKKFLYSAPRNKSHIDTCLHAYIFRPEVYQLPICKLKELFEENRKLQQFSPLSDYEGQEEEMNGTKMKFGKRNNSRGEAIISGKQRSSHSLDYDKDRVKELINLIQCRKKSVGGDSDTEDMRSKTVLKRKLEDLPENMRKLAKTSNLSENCHLYEESPQPIGSLGHDADLRRQQQDTCNSGIADIHRLFNWLSETLANARHSDASLTDTVNKALGLSTDDAYEELRQKHEYELNSTPDKKDYEQPTCAKVENAQFKGTQSLLLEVDATSKYSVAISTSEVGTDHKLHLKEDPNLISVNNFEDCSLCPSVPIEHGFRRQQSKSNNVEETEIHWKLIPITGGNARSPEDQLGKHGEKQTPGMKSPEEQLVCVPPQEAFPNDPRVINRQRSSDYQFPSSPFTDTLKGTTEDDVLTGQVEEQCVPAAEAEPPAVSETTERTVLGEYNLFSRKIEEILKQKNVSYVSTVSTPIFSTQEKMKRLSEFIYSKTSKAGVQEFVDGLHEKLNTIIIKASAKGGNLPPVSPNDSGAKIASNPLERHVIPVSSSDFNNKHLLEPLCSDPLKDTNSDEQHSTSALTEVEMNQPQHATELMVTSDHIVPGDMAREPVEETTKSPSDVNISAQPALSNFISQLEPEVFNSLVKIMKDVQKNTVKFYIHEEEESVLCKEIKEYLIKLGNTECHPEQFLERRSKLDKLLIIIQNEDIAGFIHKIPGLVTLKKLPCVSFAGVDSLDDVKNHTYNELFVSGGFIVSDESILNPEVVTVENLKNFLTFLEELSTPEGKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLESQSALLENDEKDEEDMSLDSGDEISHIEVCSNFHSEIWEKETKGSRGTDQKKNTQIELQSSPDVQNSLLEDKTYLDSEERTSIDIVCSEGENSNSTEQDSYSNFQVYHSQLNMSHQFSHFNVLTHQTFLGTPYALSSSQSQENENYFLSAYTESLDRDKSPPPLSWGKSDSSRPYSQEK DIP protein Q9UK61 original sequence version: 83 A8BE5ED05A96C897 mpp8_human M-phase phosphoprotein 8 MPP8 Two hybrid-associated protein 3 with RanBPM MPHOSPH8 protein protein human Homo sapiens Human MEQVAEGARVTAVPVSAADSTEELAEVEEGVGVVGEDNDAAARGAEAFGDSEEDGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAKAVRKDIQRLSLNNDIFEANSDSDQQSETKEDTSPKKKKKKLRQREEKSPDDLKKKKAKAGKLKDKSKPDLESSLESLVFDLRTKKRISEAKEELKESKKPKKDEVKETKELKKVKKGEIRDLKTKTREDPKENRKTKKEKFVESQVESESSVLNDSPFPEDDSEGLHSDSREEKQNTKSARERAGQDMGLEHGFEKPLDSAMSAEEDTDVRGRRKKKTPRKAEDTRENRKLENKNAFLEKKTVPKKQRNQDRSKSAAELEKLMPVSAQTPKGRRLSGEERGLWSTDSAEEDKETKRNESKEKYQKRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQLEWMKLEDFQKHLDGKDENFAATDAIPSNVLRDAVKNGDYITVKVALNSNEEYNLDQEDSSGMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSALHFAKQSNNVLVYDLLKNHLETLSRVAEETIKDYFEARLALLEPVFPIACHRLCEGPDFSTDFNYKPPQNIPEGSGILLFIFHANFLGKEVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRLTEAPSAKVKLLIGAYRVQLQ DIP protein Q99549 original sequence version: 126 DD75D14C3DBF5E95 setb1_human Histone-lysine N-methyltransferase SETDB1 SETDB1 KIAA0067 KMT1E SET domain bifurcated 1 ERG-associated protein with SET domain Histone H3-K9 methyltransferase 4 Lysine N-methyltransferase 1E ESET protein protein human Homo sapiens Human MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRPNMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPSALPAPPAPPVFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL DIP protein Q15047 original sequence version: 167 DIP protein Q15047 original sequence version: 124 D8841B4C41B911C5 h3(121)-cbx5-1 4 11 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association fam208a-mphosph8-1 1 13 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association h3(121)-cbx5-2 2 11 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human association association setdb1-fam208a-1 8 14 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human association association mphosph8-fam208a-1 3 13 unspecified role unspecified role bait bait human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association pphln1-fam208a-1 6 10 unspecified role unspecified role bait bait human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human association association fam208a-mphosph8-2 7 10 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human association association h3(121)-mphosph8-1 5 9 unspecified role unspecified role bait bait K9me1 K9me1 me1lys monomethylated L-lysine Me1Lys Methyl Methylation methylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm Biotin-tag Biotin-tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association