HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. PloS one 2014 imex curation Gründel A., Friedrich K., Pfeiffer M., Jacobs E., Dumke R. roger.dumke@tu-dresden.de Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Gründel A., Friedrich K., Pfeiffer M., Jacobs E., Dumke R. roger.dumke@tu-dresden.de Accepted 2017-FEB-28 AT 14:12 GMT AT 14:12 GMT by MGT PloS one 2014 imex curation Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. PloS one 2014 imex curation Gründel A., Friedrich K., Pfeiffer M., Jacobs E., Dumke R. roger.dumke@tu-dresden.de Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage predetermined predetermined participant predetermined Gründel A., Friedrich K., Pfeiffer M., Jacobs E., Dumke R. Wells of ELISA plates were coated with rPDHB and incubated with plasminogen. Urokinase (uPA) and plasmin-specific substrate (D-Val- Leu-Lys-p-nitroanilide dihydrochloride) were added and incubated overnight. The activity of plasmin (p-nitroaniline formation) was detected by measuring the absorbance at 405 nm. roger.dumke@tu-dresden.de Accepted 2017-FEB-28 AT 14:12 GMT AT 14:12 GMT by MGT PloS one 2014 imex curation Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. PloS one 2014 imex curation Gründel A., Friedrich K., Pfeiffer M., Jacobs E., Dumke R. roger.dumke@tu-dresden.de Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Gründel A., Friedrich K., Pfeiffer M., Jacobs E., Dumke R. roger.dumke@tu-dresden.de Accepted 2017-FEB-28 AT 14:12 GMT AT 14:12 GMT by MGT PloS one 2014 imex curation sodium chloride sodium chloride chlorure de sodium cloruro sodico common salt halite Kochsalz NaCl natrii chloridum Natriumchlorid rock salt salt sodium chloride table salt sodium chloride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 6-aminohexanoic acid 6-aminohexanoic acid 6-Aminocaproic acid 6-Aminohexanoic acid 6-AMINOHEXANOIC ACID acide aminocaproque acido aminocaproico acidum aminocaproicum Ahx Amicar Amikar AMINOCAPROIC aminocaproic acid aminohexanoic acid Capralense Capramol Caproamin Caprocid Caprolisin EACA Epsamon Epsicaprom Epsicapron Epsikapron Epsilcapramin Epsilcapramine Epsilon S epsilon-Ahx epsilon-amino-n-hexanoic acid epsilon-aminocaproic acid epsilon-aminohexanoic acid epsilon-leucine epsilon-norleucine omega-aminocaproic acid omega-aminohexanoic acid Respramin Z 6-aminohexanoic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) plmn_human Plasminogen PLG protein protein human Homo sapiens Human MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 8B31CB877CCB3AB6 dldh_mycpn Dihydrolipoyl dehydrogenase Dihydrolipoamide dehydrogenase E3 component of pyruvate complex MP448 MPN_390 pdhD protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MNYDLIIIGAGPAGYVAAEYAGKHKLKTLVVEKEYFGGVCLNVGCIPTKTLLKRAKIVDYLRHAQDYGISINGQVALNWNQLLEQKGKVVSKLVGGVKAIIASAKAETVMGEAKVLDPNTVEVAGKTYTTKSIVVATGSRPRYLTLPGFAEARQNGFVIDSTQALSLEGVPRKLVVVGGGVIGIEFAFLYASLGSEVTILQGVDRILEIFDTEVSDLVAKLLQTKNVKIITNAQVTRANNNEVFYSQNGQEGSVVGDRILVSIGRIPNTECLDGLNLQRDERNRIVLNQDLQTSIPNIYIVGDANAQLMLAHFAYQQGRYAVNHILNKKQVKPAQKLTCPSCIYTNPEVASVGYTEMELKKQGIPYVKTNLVLAHCGKAIADNETNGFVKMMFDPQTGKILGCCIIAATASDMIAELALAMGAGLTVFDIANSISPHPTINEMIADVCKKALFDHFK EB044FD676F3F28E odpb_mycpn Pyruvate dehydrogenase E1 component subunit beta MP446 MPN_392 pdhB protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MSKTIQANNIEALGNAMDLALERDPNVVLYGQDAGFEGGVFRATKGLQKKYGEERVWDCPIAEAAMAGIGVGAAIGGLKPIVEIQFSGFSFPAMFQIFTHAARIRNRSRGVYTCPIIVRMPMGGGIKALEHHSETLEAIYGQIAGLKTVMPSNPYDTKGLFLAAVESPDPVVFFEPKKLYRAFRQEIPADYYTVPIGQANLISQGNNLTIVSYGPTMFDLINMVYGGELKDKGIELIDLRTISPWDKETVFNSVKKTGRLLVVTEAAKTFTTSGEIIASVTEELFSYLKAAPQRVTGWDIVVPLARGEHYQFNLNARILEAVNQLLK 06513520FDAFED54 odp2_mycpn Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex E2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex MP447 MPN_391 pdhC protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MANEFKFTDVGEGLHEGKVTEILKKVGDTIKVDEALFVVETDKVTTELPSPYAGVITAITTNVGDVVHIGQVMAVIDDGAGAAAPAAPQPVSAPAPAPTPTFTPTPAPVTTEPVVEEAGASVVGEIKVSNSVFPIFGVQPSAPQPTPAPVVQPTSAPTPTPAPASAAAPSGEETIAITTMRKAIAEAMVKSHENIPATILTFYVNATKLKQYRESVNGLALSKYNMKISFFAFFVKAIVNALKKFPVFNGRYDKERNLIVLNKDVNVGIAVDTPDGLIVPNIKQAQTKSVVDIAKDIVDLANRARSKQIKLPDLSKGTISVTNFGSLGAAFGTPIIKHPEMCIVATGNMEERVVRAEGGVAVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDLEVA F09314A9E714A1D6 urok_human Urokinase-type plasminogen activator PLAU protein protein human Homo sapiens Human MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL DIP protein P00749 original sequence version: 130 62C72400BC23115F odpa_mycpn Pyruvate dehydrogenase E1 component subunit alpha MP445 MPN_393 pdhA protein protein mycpn Mycoplasma pneumoniae (strain ATCC 29342 / M129) MAILIKNKVPTTLYQVYDNEGKLMDPNHKITLSNEQLKHAFYLMNLSRIMDKKMLVWQRAGKMLNFAPNLGEEALQVGMGMGLNENDWFCPTFRSGALMLYRGVKPEQLLLYWNGNENGSKIEAKYKTLPINITIGAQYSHAAGLGYMLHYKKLPNVAVTMIGDGGTAEGEFYEAMNIASIHKWNSVFCINNNQFAISTRTKLESAVSDLSTKAIAVNIPRIRVDGNDLIASYEAMHEAANYARSGNGPVLIEFFSWRQGPHTTSDDPSIYRTKEEEAEAMKSDPVKRLRNFLFDRGILTPQQEEEMVAKIEQEVQAAYEVMVSKTPVTLDEVFDYNYEKLTPDLARQKAEAKKYFKD E6184A2026D7A143 pdha-plg-2 3 11 unspecified role unspecified role prey prey n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait physical association physical association 4A pdhb-plg-5 3 8 unspecified role unspecified role prey prey n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait physical association physical association 4A pdhc-plg-2 3 9 unspecified role unspecified role prey prey n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait physical association physical association 4A pdhd-plg-1 3 7 unspecified role unspecified role prey prey n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait physical association physical association 4A pdhb-plg-6 1 5 inhibitor inhibitor unspecified role unspecified role 8 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5 pdha-plg-3 1 4 inhibitor inhibitor unspecified role unspecified role 11 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5 pdhc-plg-3 1 4 inhibitor inhibitor unspecified role unspecified role 9 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5 pdhd-plg-2 1 7 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5 pdha-plg-4 1 5 inhibitor inhibitor unspecified role unspecified role 11 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5 pdhc-plg-4 1 5 inhibitor inhibitor unspecified role unspecified role 9 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5 pdhb-plg-8 1 8 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4, 5B e-aminocaproic acid (ACA) did not affect interaction with the P3 peptide upa-plg-1 2 8 stimulator stimulator unspecified role unspecified role ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role 10 enzyme enzyme unspecified role unspecified role cleavage cleavage reaction cleavage 6A pdhd-plg-3 1 7 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 inhibitor inhibitor unspecified role unspecified role 6 unspecified role unspecified role prey prey physical association physical association 4B and 5i pdha-plg-5 1 11 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5i pdhc-plg-5 1 9 unspecified role unspecified role bait bait n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association 4B and 5i