IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. PloS one 2014 imex curation Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org Accepted 2018-MAY-23 AT 09:48 BST AT 09:48 BST by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation added exp. preps; I have added Exp. Preps and figure legend, but no species of origin is given for p53 so have not added the +ve control.; done Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. PloS one 2014 imex curation Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org Accepted 2018-MAY-23 AT 09:48 BST AT 09:48 BST by PPORRAS human fetal brain cDNA library (Clontech) PloS one 2014 Only protein-protein interactions imex curation imex curation added exp. preps; I have added Exp. Preps and figure legend, but no species of origin is given for p53 so have not added the +ve control.; done Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. PloS one 2014 imex curation Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org Accepted 2018-MAY-23 AT 09:48 BST AT 09:48 BST by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation added exp. preps; I have added Exp. Preps and figure legend, but no species of origin is given for p53 so have not added the +ve control.; done Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. PloS one 2014 imex curation Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 293H cells;a variant of the 293 cell line that demonstrates better adherence in monolayer culture anand@ggc.org Accepted 2018-MAY-23 AT 09:48 BST AT 09:48 BST by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation added exp. preps; I have added Exp. Preps and figure legend, but no species of origin is given for p53 so have not added the +ve control.; done Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment. PloS one 2014 imex curation Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-neuro_2_a Mus musculus albino neuroblastoma cell line neuro 2 a (N2a) neuro_2_a Mouse Albino neuroblastoma neuro 2 a cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu YF., Sowell SM., Luo Y., Chaubey A., Cameron RS., Kim HG., Srivastava AK. same group as pmid:19012874 anand@ggc.org Accepted 2018-MAY-23 AT 09:48 BST AT 09:48 BST by PPORRAS PloS one 2014 Only protein-protein interactions imex curation imex curation added exp. preps; I have added Exp. Preps and figure legend, but no species of origin is given for p53 so have not added the +ve control.; done glym_human Serine hydroxymethyltransferase, mitochondrial SHMT2 Glycine hydroxymethyltransferase Serine methylase protein protein human Homo sapiens Human MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH 7A13AF741C68FFD6 myo16_human Unconventional myosin-XVI MYO16 KIAA0865 Unconventional myosin-16 MYO16B NYAP3 Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3 protein protein human Homo sapiens Human MEIDQCLLESLPLGQRQRLVKRMRCEQIKAYYEREKAFQKQEGFLKRLKHAKNPKVHFNLTDMLQDAIIHHNDKEVLRLLKEGADPHTLVSSGGSLLHLCARYDNAFIAEILIDRGVNVNHQDEDFWTPMHIACACDNPDIVLLLVLAGANVLLQDVNGNIPLDYAVEGTESSSILLTYLDENGVDLTSLRQMKLQRPMSMLTDVKHFLSSGGNVNEKNDEGVTLLHMACASGYKEVVSLILEHGGDLNIVDDQYWTPLHLAAKYGQTNLVKLLLMHQANPHLVNCNEEKASDIAASEFIEEMLLKAEIAWEEKMKEPLSASTLAQEEPYEEIIHDLPVLSSKLSPLVLPIAKQDSLLEKDIMFKDATKGLCKQQSQDSIPENPMMSGSTKPEQVKLMPPAPNDDLATLSELNDGSLLYEIQKRFGNNQIYTFIGDILLLVNPYKELPIYSSMVSQLYFSSSGKLCSSLPPHLFSCVERAFHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAGASRATLDSRFKHVVCILEAFGHAKTTLNDLSSCFIKYFELQFCERKQQLTGARIYTYLLEKSRLVSQPLGQSNFLIFYLLMDGLSAEEKYGLHLNNLCAHRYLNQTIQDDASTGERSLNREKLAVLKRALNVVGFSSLEVENLFVILAAILHLGDIRFTALNEGNSAFVSDLQLLEQVAGMLQVSTDELASALTTDIQYFKGDMIIRRHTIQIAEFFRDLLAKSLYSRLFSFLVNTMNSCLHSQDEQKSMQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHYINEVLFLHEQVECVQEGVTMETAYSPGNQNGVLDFFFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMYDVVGAIEKNKDSLSQNLLFVMKTSENVVINHLFQSKLSQTGSLVSAYPSFKFRGHKSALLSKKMTASSIIGENKNYLELSKLLKKKGTSTFLQRLERGDPVTIASQLRKSLMDIIGKLQKCTPHFIHCIRPNNSKLPDTFDNFYVSAQLQYIGVLEMVKIFRYGYPVRLSFSDFLSRYKPLADTFLREKKEQSAAERCRLVLQQCKLQGWQMGVRKVFLKYWHADQLNDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQNTEDMGLKTYDALVIQNASDIARENDRLRSEMNAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAVDGLGQCLVGPSIWSPSLHSVFSMDDSSSLPSPRKQPPPKPKRDPNTRLSASYEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLHGASPPLLHRAPEDEAAGPPGDACDIPPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQKGDGDRPASPGLALFNGSGRASPPSTPPPPPPPPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKPNSAPVAGPCSSFPKIPYSPVKATRADARKAGSSASPPAPYSPPSSRPLSSPLDELASLFNSGRSVLRKSAAGRKIREAEGFETNMNISSRDDPSTSEITSETQDRNANNHGIQLSNSLSSAITAENGNSISNGLPEEDGYSRLSISGTGTSTFQRHRDSHTTQVIHQLRLSENESVALQELLDWRRKLCEEGQDWQQILHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWDTTI B2D821DD53BD109E ufc1_human Ubiquitin-fold modifier-conjugating enzyme 1 UFC1 CGI-126 HSPC155 protein protein human Homo sapiens Human MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ 1675D9187DC43E14 kirr3_human Kin of IRRE-like protein 3 Kin of irregular chiasm-like protein 3 Nephrin-like protein 2 UNQ5923/PRO4502/PRO19814 KIRREL3 KIAA1867 NEPH2 protein protein human Homo sapiens Human MKPFQLDLLFVCFFLFSQELGLQKRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPVILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRNLKGVVSAKNDIRVEIVHKEPASGREGEEHSTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDPTNGYYSVNTFKEHHSTPTISLSSCQPDLRPAGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV 8AD1694D3B376B0A p46821-pro_0000018605 MAP1 light chain LC1 MAP1B protein protein human Homo sapiens Human DRSPSPRHPDVSMVDPEALAIEQNLGKALKKDLKEKTKTKKPGTKTKSSSPVKKSDGKSKPLAASPKPAGLKESSDKVSRVASPKKKESVEKAAKPTTTPEVKAARGEEKDKETKNAANASASKSAKTATAGPGTTKTTKSSAVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRAVLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLASSSTVVMQDESFPACKIEL 2207 2468 A069C385F7B012B9 p14873-pro_0000018607 MAP1 light chain LC1 MAP1(X) MAP1.2 Map1b Mtap1b Mtap5 protein protein mouse Mus musculus Mouse DRSPSPRHPDVSMVDPDALAVDQNLGKALKKDLKEKTKTKKPGTKTKSSSPVKKGDGKSKPLAASPKPGALKESSDKVSRVASPKKKESVEKATKTTTTPEVKATRGEEKDKETKNAANASASKSAKTATAGPGTTKTAKSSTVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRAVLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLASSSTVVMQDESFPACKIEL 2203 2464 FE25418FF410B5E9 at1b1_human Sodium/potassium-transporting ATPase subunit beta-1 Sodium/potassium-dependent ATPase subunit beta-1 ATP1B1 ATP1B protein protein human Homo sapiens Human MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS 107D3C04394F2D11 w476us5etzgrz-1 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure kirrel3-map1b-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure i kirrel3-myo16-1 2 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed icd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure ii kirrel3-atp1b1-1 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed icd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure iii kirrel3-ufc1-1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed icd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure iv kirrel3-shmt2-1 3 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed icd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2H kirrel3-map1b-2 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2C kirrel3-myo16-2 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2D kirrel3-atp1b1-2 3 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed icd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2F kirrel3-ufc1-2 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed icd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2G kirrel3-map1b-3 4 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 3A1 map1b-kirrel3-1 5 11 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3A2 kirrel3-map1b-4 4 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 3B myo16-kirrel3-1 4 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 3C kirrel3-atp1b1-3 4 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 3D kirrel3-ufc1-3 4 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 3E map1b-kirrel3-2 1 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 4A kirrel3-map1b-5 1 7 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 4B kirrel3-map1b-6 1 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 5A atp1b1-kirrel3-1 1 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 5B kirrel3-ufc1-4 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 5C