DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. Structure (London, England : 1993) 2015 imex curation Banerjee A., Tsai CL., Chaudhury P., Tripp P., Arvai AS., Ishida JP., Tainer JA., Albers SV. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Banerjee A., Tsai CL., Chaudhury P., Tripp P., Arvai AS., Ishida JP., Tainer JA., Albers SV. DIP original experiment: DIP-265406X Structure (London, England : 1993) 2015 IMEx FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. Structure (London, England : 1993) 2015 imex curation Banerjee A., Tsai CL., Chaudhury P., Tripp P., Arvai AS., Ishida JP., Tainer JA., Albers SV. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Banerjee A., Tsai CL., Chaudhury P., Tripp P., Arvai AS., Ishida JP., Tainer JA., Albers SV. DIP original experiment: DIP-265404X Structure (London, England : 1993) 2015 IMEx FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. Structure (London, England : 1993) 2015 imex curation Banerjee A., Tsai CL., Chaudhury P., Tripp P., Arvai AS., Ishida JP., Tainer JA., Albers SV. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Banerjee A., Tsai CL., Chaudhury P., Tripp P., Arvai AS., Ishida JP., Tainer JA., Albers SV. DIP original experiment: DIP-265405X Structure (London, England : 1993) 2015 IMEx FlaF Is a β-Sandwich Protein that Anchors the Archaellum in the Archaeal Cell Envelope by Binding the S-Layer Protein. q4j9k8_sulac Saci_1175 protein protein sulac Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) MGVSQTLAFILITFIGVSFGIVLLSAYFKSQQILNQAQELNHELELEQLETKITVSSVSLTGSTLNVVLENNGSTNLYDFQGFSVIVQYYANISNISTFNLSLYNYTKNSNPSPYYWTINTPLLAPGSQATLTIILPYPPYPNTQATVVIVTNYGPSVIWRGSL DIP protein Q4J9K8 original sequence version: 38 q4j9k8_sulac-1 2 4 unspecified role unspecified role unspecified role unspecified role Region 35-164 Region 35-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q4j9k8_sulac-2 3 4 unspecified role unspecified role unspecified role unspecified role Region 35-164 Region 35-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q4J9K8:p.Ile86Lys I86K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I K This feature has been corrected as a result of our quality control procedures. The original label was 'I86K'. Wed May 02 20:11:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile86lys' Tue Jun 30 19:29:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile86Lys' ecolx Escherichia coli direct interaction direct interaction q4j9k8_sulac-3 1 4 unspecified role unspecified role unspecified role unspecified role Region 35-164 Region 35-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q4J9K8:p.Ile86Lys I86K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I K This feature has been corrected as a result of our quality control procedures. The original label was 'I86K'. Wed May 02 18:17:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile86lys' Tue Jun 30 20:24:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile86Lys' Q4J9K8:p.Leu101Tyr L101Y mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L Y This feature has been corrected as a result of our quality control procedures. The original label was 'L101Y'. Wed May 02 16:21:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu101tyr' Tue Jun 30 18:35:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu101Tyr' ecolx Escherichia coli direct interaction direct interaction